(data stored in ACNUC7421 zone)

EMBL: AP009493.PE81

AP009493.PE81        Location/Qualifiers
FT   CDS_pept        84532..84825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_81t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_81t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16910"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM09"
FT                   /protein_id="BAG16910.1"
FT                   /translation="MDTVVRDFQNTYAQAPAQEDLARLLTLVLNSRDLPDADREEAAGA
FT                   VHDLARITAGPEPDTATARTRLQRLRELLTAGADITQPALAIVTSVAGMLGA"
     gtggacaccg tcgtacgcga cttccagaat acctacgcac aagcccccgc acaggaagac        60
     ctggcccgcc tgctcaccct tgttctgaac agccgggacc tccccgatgc cgaccgcgag       120
     gaggcggccg gcgcggtcca cgacctggcc cgcatcactg ccgggccgga gccggatacc       180
     gccaccgccc gcacccgcct ccagcggctt cgcgaacttc tcaccgccgg ggccgatatc       240
     acccagcccg cgctggccat cgtgacgtcg gtggcgggga tgctgggggc gtga             294
//

If you have problems or comments...

PBIL Back to PBIL home page