(data stored in ACNUC7421 zone)

EMBL: AP009493.PE82

AP009493.PE82        Location/Qualifiers
FT   CDS_pept        complement(84916..85536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_82t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_82t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16911"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM10"
FT                   /protein_id="BAG16911.1"
FT                   /translation="MGMDLTVFMVDWGQLGTVPVEHRIGRLEDLAWPGELSDVYDGGAE
FT                   RAHGWLWPPGQAPAWCAVYRFLTTTGAHMPHVRAGAAWADMRPLVGPPVREVMDSFLEG
FT                   LIWDGDQADAPAPVGVGAFPAAADRWHPNVLLVCLPEAVAGKARAWERMELYLEKLSGP
FT                   FAVECEGWAGRPDTFEGFVALLREWGAVVTEAARRGWGLVGLP"
     atgggtatgg acctcacggt gttcatggtg gactgggggc agttgggcac cgtccctgtc        60
     gagcaccgga tcggacggct tgaggacttg gcttggccgg gcgagctgag cgacgtgtac       120
     gacggcgggg ccgagcgggc ccacggctgg ctctggcctc ctggacaagc accggcgtgg       180
     tgcgccgtat acaggttcct caccaccacc ggcgcccaca tgccgcatgt ccgcgcgggt       240
     gccgcatggg ctgacatgcg tccgctcgtc ggcccgcccg tgcgtgaggt gatggacagc       300
     ttcctcgaag gtctgatctg ggacggggac caggccgacg ctccggcgcc ggtcggcgtc       360
     ggagctttcc cggctgccgc cgaccgctgg cacccgaatg tccttctggt ctgtctgccg       420
     gaggcggtgg cggggaaggc tcgggcctgg gaacggatgg agctgtacct ggagaagttg       480
     agcggcccgt tcgctgtcga gtgcgagggc tgggcgggcc gcccggacac cttcgagggc       540
     ttcgttgccc ttctgcggga atggggcgcg gtggtcacgg aggccgctcg ccgtgggtgg       600
     ggcctcgtgg ggctgccctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page