(data stored in ACNUC7421 zone)

EMBL: AP009493.PE83

AP009493.PE83        Location/Qualifiers
FT   CDS_pept        complement(85734..86078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_83t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_83t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16912"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM11"
FT                   /protein_id="BAG16912.1"
FT                   /translation="MPGGIVSPRSYGRRQVPGRPGPVSERSGHMGEINVSSRDLGRLLT
FT                   DRTGTPARPYQEAFAKLADTYRGKPVPEILPLLRQAADEALLGFTDADLREQAEAIRSG
FT                   ARYVLRVRVT"
     gtgccgggcg ggattgtcag tccccgctcg tacggtcgaa gacaggtgcc ggggcggccg        60
     gggccggtaa gcgagcggag cgggcacatg ggcgagatca acgtgagcag ccgggatctg       120
     gggcggctcc tcaccgaccg caccggcacc ccggcgcgcc cctaccagga ggcgttcgcc       180
     aagctggccg acacctaccg gggaaagccg gtcccggaga tcctgccgct gctgcgccag       240
     gccgcggatg aagcgctgct cgggttcacc gacgcggatc tgcgggagca ggcggaggcg       300
     atccggtccg gcgcacggta cgtgctgcga gtccgcgtca cgtag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page