(data stored in ACNUC7421 zone)

EMBL: AP009493.PE84

AP009493.PE84        Location/Qualifiers
FT   CDS_pept        complement(86151..86822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_84t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_84t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16913"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM12"
FT                   /protein_id="BAG16913.1"
FT                   /translation="MIKNLVRGFSALSLALVPFLSAPAAQAAPAAEVTTLADAVGLVQV
FT                   TEEDRTGYTRSSFKHWNSGDNASDGCNTRAEVLISEAVVAPAVGAGCKLTGGTWISYYD
FT                   GQEVTSAGSLDIDHMVPLAEAWDSGASAWTAARREAYANDQGAHVSLVAVTARSNRQKS
FT                   DQDPADWMPPSPDAECRYVAEWVSTKLRWQLTADDRELEALKVYADGPCEDTIVRYTPA
FT                   A"
     gtgatcaaga accttgtgcg cggtttcagc gcgctttccc tcgcccttgt cccgtttctc        60
     tccgctcccg ccgctcaggc cgctcctgcg gctgaggtga cgacgctggc cgacgcggtc       120
     ggtctggtgc aggtcacaga ggaggaccgc accggctaca cccgctcgtc cttcaagcac       180
     tggaactccg gcgacaacgc ttcggacggg tgcaacaccc gcgctgaggt cctcatctcc       240
     gaagcggtcg tcgccccggc cgtgggggcc ggctgcaagc tgaccggcgg cacctggatc       300
     agctattacg acggccagga ggtcaccagc gccgggtctc tggacatcga ccacatggtg       360
     ccgctggccg aagcgtggga ctccggcgcc tccgcctgga cggcggcgcg gcgggaggcg       420
     tacgcgaacg accagggggc gcacgtctcg ctcgtcgcgg tgacggcccg ctccaaccgg       480
     cagaagtcgg atcaggaccc ggcggactgg atgccgccgt ccccggacgc cgagtgccgg       540
     tacgtcgcgg agtgggtgtc gaccaagctc cgctggcagc tcaccgcgga tgaccgcgag       600
     ctcgaagcgc tgaaggtcta cgccgacggc ccgtgcgagg acaccatcgt ccgctacacc       660
     ccggccgcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page