(data stored in ACNUC7421 zone)

EMBL: AP009493.PE85

AP009493.PE85        Location/Qualifiers
FT   CDS_pept        complement(87010..87465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_85t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_85t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16914"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM13"
FT                   /protein_id="BAG16914.1"
FT                   /translation="MRFPAEARRDVHVRYTRPSCMGGFAVFTVDFEPLPDRRLGFEFVN
FT                   PLGPDDIDAECAQEVSNGILLWLIGAGPQNVYIDRPPLPTAKELAAGVPVRPDAGPGLI
FT                   ALRAVLLHSRHHPIDSLPWTHARAGWRAADKTWRGTEAAGDPMDLAP"
     atgcgattcc ccgccgaagc ccgccgcgac gtccacgtcc gctacacccg gcccagctgc        60
     atgggcggct tcgcggtatt taccgtggac ttcgagccgc tcccggaccg gcggctcggc       120
     ttcgaattcg tcaacccgct cggtcccgac gacatcgacg ccgagtgcgc gcaggaggtg       180
     agcaacggga tactgctgtg gctgatcgga gcaggaccgc agaacgtcta catcgaccgc       240
     ccgcccctcc ccacggcgaa ggagctcgct gcgggagtac ccgtccgacc ggacgccggc       300
     ccggggctca tcgcccttcg cgcggtactc ctacactcac gccaccaccc catcgactcc       360
     ctgccctgga cccatgcgcg cgccgggtgg cgagccgccg acaagacctg gcggggcaca       420
     gaggcagccg gtgacccgat ggacctcgca ccatag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page