(data stored in ACNUC7421 zone)

EMBL: AP009493.PE88

AP009493.PE88        Location/Qualifiers
FT   CDS_pept        88686..88982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_88t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_88t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16917"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM16"
FT                   /protein_id="BAG16917.1"
FT                   /translation="MAVLCSQPTILYPHLQPASRVGRLVEVFTLGASDTKRAGSVLRSV
FT                   ALAVQQPLAAGRDRHHHQVWGLSWQAGGPESSPAVARSREVTGRGLLVSLVFC"
     atggccgtgc tgtgttcgca gccgacgatc ctttacccac atctgcagcc tgcttcgcgc        60
     gtggggaggc tggtcgaggt ctttacgctc ggtgcgtcgg acacgaagcg ggccggatct       120
     gtgttgcggt ccgtcgcgct cgctgtgcag cagcctctgg ctgccgggcg agaccggcat       180
     caccaccagg tctggggtct gtcctggcag gccgggggcc cggaaagctc gccagcagtc       240
     gcaaggagcc gcgaggtcac cggacgcggc ctgttggtca gcctggtgtt ctgctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page