(data stored in ACNUC7421 zone)

EMBL: AP009493.PE89

AP009493.PE89        Location/Qualifiers
FT   CDS_pept        complement(89693..90163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_89t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_89t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16918"
FT                   /db_xref="GOA:B1VM17"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM17"
FT                   /protein_id="BAG16918.1"
FT                   /translation="MIQQPPHPVRTPLGAGRLSSDIHRLGNVLPPGTTVPIRPDLSREK
FT                   VVNLLLDSPSTLHQFPQTLTRVRRLQQKASQPMSLSRNLMPRRRPGVTGGRPLPFPPPL
FT                   RLTPMPLVTIGTAPPRAAGGRKRRPTETTDTTRSIPCHRILLRADRRHRHPR"
     gtgatccagc agccgccgca cccggtccgg actccacttg gtgcgggccg tctcagcagt        60
     gacattcacc gccttggcaa tgtcctccca cctggcacca cggtcccgat ccgccccgac       120
     ctcagccgcg agaaagtagt caatctcctg ctggacagcc cgagcacgct gcaccagttc       180
     ccccagaccc tcacccgcgt acgtcgcctc caacagaagg ccagccagcc gatgagcctc       240
     agccgcaatc tcatgccccg gagacgtccc ggcgtgaccg gcggcaggcc tctcccgttc       300
     ccgccgcctc tgcgcctgac gccgatgccc ctcgtcacaa taggaacggc gcctccccgg       360
     gccgctggcg gcaggaagcg acgccccaca gaaaccacag acacgactcg cagcatccct       420
     tgtcaccgca tcctccttcg cgctgatcgc cgtcaccggc atccccgctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page