(data stored in ACNUC7421 zone)

EMBL: AP009493.PE9

AP009493.PE9         Location/Qualifiers
FT   CDS_pept        complement(14290..17832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_9t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_9t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16838"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B1VKK7"
FT                   /protein_id="BAG16838.1"
FT                   /translation="MASALAAESGERVAVDEATTDSSQVFANPDGTFTQEMNAAPVRAR
FT                   KTDGAWAPIDTTLVREADGSIRAKNTTAALTFSGGGSGTGLVTLKDDGHELKLGWPTEL
FT                   PEPRLDANTATYADVLPAVDLKLTALSSGYTSVLVVKTAQAAANPALATIEMTISGGSL
FT                   DIAATADGGFVARDGDGTPVFESPAGRMWDSAGDNPATASTTSARSAASAESVVVPEAE
FT                   GEPAPSEAPSSGDAEAELPLKVTGTTMEITPDPALLKGKDTVFPLYIDPPTKGIALGDW
FT                   TALSSDGDKFWEFDGDKGVGRCSNHAGYLCSNSPYTQRLYFEYPLSSIHGKKILDATME
FT                   VYQVWTFTCDPHWYDLSTVDKGITSSTTWSVRPKEINLMGDRNVAYGRGGLCDPSQPAN
FT                   WVRFSDNLDETNENLTPTLASAAQNKTSQITFSLTAHDESDAASWARFRNDAKLSVTYV
FT                   SYPSTPTSYGVQQGTTGRACTASTLPFATSDTTPKMLAAVQSADGSQSQLRALFEVWKA
FT                   DGSSRAWYAASPDGAWVADNASRDATSSALPPQTDYRMRVKTQAYYKTDRGATGVLDSS
FT                   WSSWCYFRVDTDSPPPPIVASADGIYKPAATDPAAGGVGTPGKFTFTPGDTNATTPGIQ
FT                   SDVVSYKWKLNSGAVSLSIPVAKGAPTTQSIAPNQAGENTIQVWGFDAAGHSSLTGYYS
FT                   FLVKGAEKPSGVWHLDNALTDSTTATPHALTASGVTWDAKSRSGASALKFNGTTGYAQS
FT                   SGPVVDTTKSFSLSAWARLSDLSRSQTIVSQQATTLSGFALHYSATSQRFAFSRYHSDV
FT                   ASPAASRSTAATAPVANAWTHLTGVYDAAGQTVQLFVNGRPQGQPVPFTTPWLATGSLQ
FT                   IGRFHNSTGYVEHFSGVADEVKVWARALADTEVAHDAWLEDEDLSDGTAGDPVPALVAE
FT                   WDAMDMINATGATIRDTSDFGRNLTLNGAVLTKFTTGDPELGEEVTTTQTMTLNGTSAY
FT                   ATAPGPIVDDSGSFTATAWVTLDPAKFTDTSKSYAVQVFGQSGANQSSWGVWYEQPAGS
FT                   TQGRWTFGRPDKDGTGAAWTRSDSTAFTTAQLGVPVMLTVVYDAQAAANPDDTSKLGGL
FT                   KLHVDSARMGDEDGVAYSAPWQGSGVFEIGRAKINGAAARHFPGKINSVRVWAGSTSTG
FT                   TIANRYNTEQQFQQ"
     atggcgagtg ctcttgccgc ggagagcggt gagcgcgtgg ctgtggacga ggcgaccacc        60
     gattcatctc aggtgtttgc caacccggac ggcaccttca cgcaagagat gaacgcagct       120
     ccggtccgtg cccgcaagac cgacggcgct tgggctccca tcgacaccac cctcgtgcgt       180
     gaggccgatg gatcgatccg ggcgaagaac accacagccg ctctcacctt ctcgggtggc       240
     ggctcgggca ccggcctggt cacgctcaag gacgacgggc atgagctgaa gctgggatgg       300
     cccaccgagc ttcccgagcc ccggctcgac gccaacaccg ccacctacgc cgacgttctc       360
     cctgctgtcg atctgaagct gactgccctc agttccggct acacctcggt gctggtcgtc       420
     aagaccgccc aggcggcggc gaacccggcg ctggccacga tcgagatgac gatctccggt       480
     ggcagtctgg atatcgctgc gactgctgat ggcggctttg tcgcgcgcga cggcgacggc       540
     accccggtgt tcgagagccc ggcgggccgg atgtgggact cggccggcga caatccggcg       600
     acggcctcga ctacgtccgc ccgttctgct gcatcggcgg agtcggtcgt ggtgccggag       660
     gccgagggcg agccggctcc ctcggaggcg ccgagcagcg gtgacgcgga ggccgagctc       720
     ccgctcaagg tcacgggcac cacgatggag atcacacctg acccggcgtt gctcaagggc       780
     aaagacacgg ttttccctct gtacatcgac ccgcccacca agggcattgc gctcggtgac       840
     tggacggcgc tgtcctcgga cggcgacaag ttctgggagt tcgacggaga caagggtgtg       900
     ggccgctgct ccaaccacgc cggctacctg tgctccaact ctccgtacac gcagcgcctg       960
     tacttcgagt acccgctctc ctcgatccac ggcaagaaga tcctggacgc gacgatggag      1020
     gtgtaccagg tctggacgtt cacgtgcgat ccacattggt acgacctgag caccgtggac      1080
     aagggcatca cctcgagcac cacgtggtcg gtccgcccta aggagatcaa cctaatgggc      1140
     gaccggaacg tcgcctacgg ccgcgggggc ctgtgtgacc cgtcgcagcc agcgaactgg      1200
     gtccgcttca gcgacaacct cgatgagacg aacgagaacc tcacgcctac cctcgcctcc      1260
     gccgcacaga acaagacgtc gcagatcacc ttttcgttga ccgcacacga cgaatccgac      1320
     gcggcttcgt gggcccgctt ccgcaatgac gcgaagctgt ccgttactta cgtgtcctac      1380
     ccgagcaccc cgaccagcta cggcgtgcag cagggcacca ccgggcgggc ctgcactgcc      1440
     tccacgctgc cctttgccac cagtgacacc acaccgaaga tgcttgccgc ggtgcagtca      1500
     gcggacggct cccagtccca gttgcgcgca ttgttcgagg tgtggaaggc agacggctcc      1560
     agccgggcat ggtacgcggc ctccccggac ggcgcctggg tggccgacaa cgcttcccgg      1620
     gacgcgacct cgagcgcgct gcccccgcag acggactacc ggatgcgggt caagacgcag      1680
     gcgtactaca agaccgaccg gggcgctacc ggcgtcctcg actcctcttg gtcgtcctgg      1740
     tgctacttca gagtggacac cgattcgccg ccgccaccca tcgtggccag tgccgacggc      1800
     atctacaagc cggccgcgac cgacccagcc gccggcggag tcggtacgcc gggtaagttc      1860
     accttcaccc ccggggacac caacgcgacc acgcccggca tccagtccga cgtcgtgagc      1920
     tacaagtgga agctgaacag cggcgcggtc tccctgtcga tacccgtcgc caagggtgcg      1980
     ccgacgaccc agtcgattgc accgaaccag gcaggcgaga acaccatcca ggtctggggc      2040
     ttcgatgctg ccgggcacag ttcgctcacc ggctattaca gtttcctggt caagggcgcg      2100
     gaaaagccct cgggtgtctg gcacttggac aacgccctca cagactccac caccgcaacg      2160
     ccgcacgcgc tgaccgcttc cggcgtgaca tgggacgcca agtcgcgcag tggcgcgagc      2220
     gcattgaagt tcaacggcac cacaggctat gcccagtcgt cggggccggt ggtggacacg      2280
     accaagtcat tcagcctttc cgcctgggcc cggctttccg atctctcgcg cagtcagacg      2340
     attgtctccc agcaggccac caccctgtcc ggcttcgcac tgcactactc agccaccagc      2400
     cagcggttcg ccttctcccg ctaccacagt gacgtcgcct caccggcagc gagccgttcc      2460
     accgccgcca ctgcccccgt cgcaaacgcg tggacccacc tcaccggtgt ctacgacgct      2520
     gcgggccaga ccgtgcagct gtttgttaac ggccgccccc aggggcagcc cgtacccttc      2580
     accacgccat ggttggccac cggatcgctc cagatcgggc ggttccacaa cagcaccggt      2640
     tacgtcgagc acttcagtgg ggttgccgac gaggtgaagg tctgggctcg cgcactcgcg      2700
     gacaccgagg tcgcccatga cgcatggctg gaggacgaag acctcagcga cggcaccgcc      2760
     ggcgatcccg tgccggcgct cgtggccgag tgggatgcca tggacatgat taacgcaacg      2820
     ggtgccacga ttagggacac cagtgacttc ggccggaacc tcactctgaa tggggccgtc      2880
     ctgaccaagt tcaccaccgg tgacccggag ctcggcgagg aagtgacgac cacccagacg      2940
     atgaccttga acggcaccag tgcctacgcc acggccccgg ggccgatcgt cgatgactca      3000
     ggatcgttca ccgcgaccgc gtgggtgacg ctggaccccg ccaagttcac cgacaccagc      3060
     aagtcgtacg ccgtgcaggt gttcggccag tctggggcga accagtcttc ttggggtgtc      3120
     tggtacgagc agccggccgg cagcacccag gggcggtgga cgttcggccg ccccgacaag      3180
     gacggcacgg gtgctgcatg gaccaggagt gactccaccg ccttcaccac cgctcagctt      3240
     ggcgtaccag tcatgctgac cgtcgtttac gacgcccagg cagcagccaa ccctgatgac      3300
     acctccaagc tcggcgggct caagctccac gtcgacagcg ctcggatggg cgacgaagac      3360
     ggcgtggcgt actcggcccc ttggcagggc agcggagtgt tcgagatcgg ccgggcgaag      3420
     atcaatggcg ctgcggcgcg ccatttcccc gggaagatca acagcgtgcg cgtctgggcc      3480
     ggctccacct ccaccggcac gatcgccaac cggtacaaca ccgagcagca gttccagcag      3540
     tag                                                                    3543
//

If you have problems or comments...

PBIL Back to PBIL home page