(data stored in ACNUC7421 zone)

EMBL: AP009493.PE90

AP009493.PE90        Location/Qualifiers
FT   CDS_pept        90254..90799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_90t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_90t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16919"
FT                   /db_xref="GOA:B1VM18"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VM18"
FT                   /protein_id="BAG16919.1"
FT                   /translation="MAATARQRLAAALSYLQRKSGLSIRVIADRTMLSPSFISRILSGE
FT                   RLPSWDLVCHLCSILGHEPGELRLLCEAAHGIEQPPRQTVTEYIAALKAALRGLHLAAA
FT                   RPTPDEIHRRSHGLVPVQVVAQVLRGDAVPEWEVVGALVTALGGQAADFKPLWEAIHYS
FT                   FLMTDDPCVSDLVSETTG"
     atggcggcca ctgcgcgtca gaggctggct gcggccctgt cctacctgca gcgaaagagc        60
     ggtctcagca tccgagtgat cgcggaccga acgatgctct ctccttcctt catctccagg       120
     atcctgtcgg gagaacggct tccctcgtgg gatctggtgt gtcatctgtg cagcatcctg       180
     gggcacgagc ctggggagtt gaggctgttg tgcgaggcgg ctcatggcat cgagcagcct       240
     ccgcggcaga cggtgacgga gtacatcgct gcgttgaagg ctgcgttgcg ggggctgcac       300
     ctggccgctg cgcggccgac ccctgacgag attcaccggc gcagtcatgg gctggtgcct       360
     gtgcaggtcg ttgcccaggt tctacggggg gatgcggttc cggagtggga ggttgtcggg       420
     gcgctggtca ccgcgttggg tgggcaggct gcggatttca agccgctgtg ggaggcgatc       480
     cattacagct tcctgatgac ggatgacccc tgtgtcagtg atctggtcag cgagacgacc       540
     ggttga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page