(data stored in ACNUC7421 zone)

EMBL: AP009493.PE92

AP009493.PE92        Location/Qualifiers
FT   CDS_pept        91423..92244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_92t"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_92t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16921"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1VN98"
FT                   /protein_id="BAG16921.1"
FT                   /translation="MTAENQLPYGVDVRTPSVARMYDHLLDGKDNFSADRAACDHLLQQ
FT                   VPSMKDLALNNRAFLQRVVRTLAREYGIRQFIDHGSGLPTQDNVHQIAQRVDGASRVVY
FT                   VDSDPIVRSVGGALLETDDRTAVLQADMRDTQEIFDSEPVRRLIDFREPVGALFVSVLH
FT                   CIPDADRPVDLIRRVRSRLASGSVMVICQLVSESEQVRDEVSAFMDRETRGHWGRVRTR
FT                   ADVESYFEDNGLSVVEPGLVEVSRWRPADVPAAPPQQSFEWEEFGGAGLVP"
     atgacggccg agaatcagct tccgtacggt gtggacgtga ggactccgag cgtcgcgcgg        60
     atgtacgacc atcttctgga cggcaaggac aatttctccg ccgatcgtgc tgcgtgcgac       120
     cacctcttac aacaggtccc gagcatgaag gacctcgccc tgaacaaccg ggcctttctt       180
     cagcgggtag tgcggactct cgcccgggag tacggcatcc gtcagttcat cgaccacggg       240
     tcagggctgc cgacgcagga caacgtgcac cagatcgcgc agcgcgtcga cggtgcctcc       300
     agggtcgtgt acgtggacag cgatccgatc gtgcgcagtg tgggcggggc tcttctggag       360
     accgatgacc ggaccgctgt cctgcaggcg gacatgcgtg acactcagga gatcttcgac       420
     agtgagccgg tgcggcggct gattgatttc cgggagccgg tcggtgcgct gttcgtttcg       480
     gttctgcact gcattcccga tgcggaccgg cccgttgacc taatccgcag ggtgcggagc       540
     cggctggcca gcggcagtgt gatggtcatc tgccagttgg tcagcgagag cgagcaggtc       600
     cgtgatgagg tgtctgcgtt catggaccgt gagacccggg ggcactgggg ccgcgtgcgc       660
     acccgggctg acgtcgagag ctacttcgag gacaacggac tgtcggttgt cgagccgggc       720
     ctggtcgagg tctcccggtg gcgccctgcc gatgtgcctg ctgctccacc ccagcagagc       780
     tttgagtggg aggagttcgg cggggccggc ctggttccct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page