(data stored in ACNUC7421 zone)

EMBL: AP009493.PE93

AP009493.PE93        Location/Qualifiers
FT   CDS_pept        complement(92263..93192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_93t"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_93t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16922"
FT                   /db_xref="GOA:B1VN99"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1VN99"
FT                   /protein_id="BAG16922.1"
FT                   /translation="MTGQHGDNRSIRGFAPRPHLGAAAHRRALGEHLRRCRTGIGMTGK
FT                   AAARHIGTSGPTVSRLEKGERTENTGQHATALLRLCGVTDRQELSHALSIAAQGEKPDA
FT                   WEAYGNSIARWVQPLLALEPAAQRIMAYEPQLVPGWLQTTEYAQLVIRAGFPDLSQAEV
FT                   EARARARTNRLSMFHRDQDPPAMVAIMDEDVLRRPVGSPGVLYRQIEHLIQLLKSDLRH
FT                   RINLHIAPLSMGMTGAVGHPIVHLRFADALLSDFVYLEQSEGARCVEGEGEAERYLSRV
FT                   TTLSGMANPAALTLTQLEDRLDELATGR"
     atgactggcc agcacgggga caaccgttcc atacgcggtt tcgcgccccg gccccacctc        60
     ggtgcggcag cccaccgcag agccctcggc gagcacctgc gacgctgccg caccggcatc       120
     gggatgacgg ggaaagccgc ggcccgccac atcggaacat ccgggccgac ggtgagccga       180
     ctggaaaagg gcgaacggac cgagaacacc ggccagcacg ccaccgccct gctgcgtctg       240
     tgcggagtca ccgaccgcca ggaactatcc cacgcgctgt cgatcgcggc tcagggcgag       300
     aagccggatg cctgggaggc gtacggcaac tccatcgccc gctgggtgca gccgctgctc       360
     gctctcgaac cggccgccca gcggatcatg gcctacgaac cacagctcgt ccccggctgg       420
     ctgcagacca ccgaatacgc ccaactcgtc atccgtgcag gcttcccgga cctgtcccag       480
     gcagaggtcg aagcccgcgc acgggcccgg accaaccggt tgagcatgtt ccaccgggac       540
     caggacccgc cggccatggt cgcgatcatg gatgaagacg tgctgcgccg cccggtgggc       600
     agccccggcg tgctgtaccg gcagatcgag cacctgatcc agctgctcaa gagcgacctg       660
     cggcaccgca tcaacctcca catcgctccg ctctcgatgg ggatgacagg cgctgtaggg       720
     catccgatcg tgcacctgag gttcgccgac gccctgctgt ccgatttcgt ctacctcgag       780
     cagagcgaag gcgcccgctg cgtcgagggc gaaggcgagg cggaacgcta cctgtcgcgc       840
     gtcaccaccc tctccggcat ggccaacccc gccgccctca ccctgactca gctggaggac       900
     cggctcgacg agctggccac cggccgctag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page