(data stored in ACNUC7421 zone)

EMBL: AP009493.PE97

AP009493.PE97        Location/Qualifiers
FT   CDS_pept        complement(95228..95785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_97t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_97t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16926"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA3"
FT                   /protein_id="BAG16926.1"
FT                   /translation="MAQGATLGEALSHLVRDHGARPAGRLKTYRAKQWHAQLVQLTATR
FT                   HGYEALERAGLTVTARTLIHWLSEPEYAVRRSYQEQIRSAYEEAATTRPTPLPSDFQIH
FT                   QFRITGTVQIARDIRDRGTHGEAPLRIDGRNGAWARIEQAWLTGQLTDEVFEEYFIDDI
FT                   LVEDIGDGTDGWQFPGDRYVVN"
     atggctcagg gagccaccct cggcgaagcc ctcagccacc tggtgcgtga ccacggagcc        60
     cgaccggcgg gccgcctcaa gacctaccgg gcaaagcagt ggcacgctca gctcgtccaa       120
     ctgacagcaa cccgccacgg ctacgaagcc ctcgaacgcg caggcctcac cgtcacagcc       180
     cggactctga tccactggct gtcggaaccc gaatacgccg tacgccgcag ctaccaggaa       240
     cagatcagat ccgcctacga ggaagcggcc accacccgcc ccaccccgtt gccctcggac       300
     ttccagatcc accaattccg cattaccggc accgtccaga tcgcacgcga catccgggat       360
     cgcgggactc atggcgaagc cccgctgcgc atcgacggcc gcaacggcgc ctgggccaga       420
     atcgagcagg catggctcac cggtcagctg accgatgaag tatttgagga gtacttcatc       480
     gacgacatcc tcgtggagga catcggcgac gggaccgacg gctggcagtt ccccggggac       540
     cggtacgtag tgaactga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page