(data stored in ACNUC7421 zone)

EMBL: AP009493.PE98

AP009493.PE98        Location/Qualifiers
FT   CDS_pept        complement(95785..98298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_98t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_98t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16927"
FT                   /db_xref="GOA:B1VNA4"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA4"
FT                   /protein_id="BAG16927.1"
FT                   /translation="MNQEDPRRSAAPEALTVEQARASLHARVKAAEEGQATYVRRRHDE
FT                   AVLAPLEHLPAARDAASGLAAHTLTSAQRDLGDLVKAAAAGNPQVLLRRSVPVAVLLPA
FT                   RSQTPGPSNPATEAEPSTDHPGSPTAPTQVEGIAQETSSATNATPRRLAALGDVMGEVR
FT                   TSAAPAAPQFGLTVLDAAVGGLQPGCFVLVAAAPGAGGSLLALAAARHTALVANQRVLY
FT                   AASGLTRADVARRIVAAETGTDYRRLATNTLTEHEHTAVQKADARLTQAPLLIDDGSAL
FT                   TAEAIAQTAPYVNDLALIVVDRLQCAPAAHIPLSGDQLPAAARTLAHLARQSGLPVLAV
FT                   IDTDDPLLIQRLDPDVTIHLTLHKNDGTAEITVAERDFGPLATARLNEDLAHARFTDLH
FT                   HPPAHNVEDQLLRAALPFTSGARQGLPAPAHQILAAFRDAKNQGDEGLLSTLRDSVAEL
FT                   AANPPALNDGPLEQHLRTALNAYATAPSSPLPRSGEPEQTASSAPRTAAATTVAPQRED
FT                   PEPEEKVMELQPGDEHEPKDTVFPGLSILRESISRSKMHPLPAVRADQRENVPWTLFRE
FT                   FMDGEPRWVHPEAERVRNGAGKRDTLIVPDSFAPGALCTIDRNGSYPSACSAVPLAPNK
FT                   LLHTGALAERTRDQAGIFYIDVPSWTHTQMPHPLGRLADRADAHGRVWAVTSHIQLIER
FT                   LIKAGHITEPLCIHDSWTGRANESLFQHFYKEARRARTELVDAGAPYDQYKRRLSIALR
FT                   LLWPKGDTVKSPFWRPDWRMSVVAEASVRHWVTAWKAVQAGHTLIALRNVDEAVFHTPD
FT                   GTAPDTYKVGTGFGEVKVKHGQESS"
     gtgaaccagg aagatcccag gcgatcggcc gcgcccgaag ccctgacggt ggagcaggcc        60
     cgcgcctcct tgcacgcccg agtgaaggct gccgaggaag gccaggccac ctacgtccgc       120
     cgacgccacg acgaggcggt gctcgctcca ctggagcatc tgcccgcagc gcgggacgct       180
     gcatcgggtc tggctgcaca caccctgacc agcgcgcaga gagacctggg cgacctagtg       240
     aaagctgctg cagcaggaaa cccccaagtc ctcctgcgcc gctcggtccc ggtggccgtc       300
     ctcctgcccg cccgctccca aacgccgggc ccttccaacc cggcaaccga ggcggaaccg       360
     tcgaccgacc accccgggag cccgactgct cccacgcagg tggagggcat cgctcaagag       420
     acctcgtcag ccacgaacgc caccccgcgc agactcgccg ccttgggcga cgtcatgggc       480
     gaagtccgca cctctgcagc acccgccgcc ccacagttcg ggctcacggt cctggacgcc       540
     gcagtcggcg gccttcagcc cggctgcttc gtcctcgttg ccgccgcccc gggagcgggc       600
     ggaagcctcc tcgccctggc cgcagcgcgc cacaccgcac tcgtcgccaa ccaacgcgtg       660
     ctctacgcgg cttccggcct gacccgagca gacgtcgcac gccggatcgt ggcagcagag       720
     accggcaccg actaccgccg acttgccacc aataccctca ccgagcacga acacaccgca       780
     gtccaaaagg ccgacgcccg cctcacccag gccccgcttc tcatcgacga cggcagcgca       840
     ctgaccgcgg aggcgatcgc ccagaccgcc ccctacgtca acgacctggc actgattgtc       900
     gtggaccgcc tccaatgcgc accggccgcc cacattcccc tgtcgggaga ccagctccct       960
     gcggccgctc gtacgctggc gcacctcgcc cggcagtccg gccttcccgt gctcgcagtc      1020
     atcgacaccg acgatccgct cctcatccaa cggctggacc cggacgtcac catccacctc      1080
     acgctccaca agaacgacgg caccgccgaa atcacggtcg ctgagcggga cttcgggcca      1140
     ctggccaccg cccgcctcaa cgaggacctg gcccacgccc gcttcaccga cctccaccac      1200
     cccccggccc acaatgtcga ggaccagctc ctgcgcgccg ctctgccctt cacctccggc      1260
     gcccgccaag gcctgcccgc ccccgcccac cagatcctgg ccgcattccg ggacgcgaag      1320
     aaccaaggcg acgaaggact gctgtcaacg ctgcgcgact ccgtggccga actggcagcc      1380
     aaccccccag cgctgaacga cggcccgctg gaacagcacc tgcgcaccgc gctgaacgcc      1440
     tacgccaccg cgccgtcatc gccccttccg cgctccggcg aaccggaaca gaccgcctca      1500
     tcagcacccc gcaccgctgc ggcgacgacg gtcgcccccc agcgggagga ccctgagccg      1560
     gaggaaaagg tgatggagct gcagccgggc gacgagcacg agccgaagga cacggtcttc      1620
     cccggcctga gcatcctgag ggaaagcatc agccgctcca agatgcaccc cctcccggca      1680
     gtccgcgccg accagcgtga aaacgtgccg tggacgctgt tccgcgagtt catggacggt      1740
     gaaccacgct gggtccaccc ggaggccgag cgcgtccgca acggcgcagg caagcgcgac      1800
     accctcatcg ttcccgacag cttcgctccc ggcgccctgt gcaccatcga ccgcaacggc      1860
     tcctatccgt cggcctgctc cgctgttccc ctcgccccca acaaactcct ccacaccgga      1920
     gctctggccg aacgcacccg cgaccaggcc ggaatcttct acatcgacgt cccctcctgg      1980
     acccacaccc agatgcccca cccgctggga cgactcgccg accgggccga cgcccatggc      2040
     cgggtatggg ccgtcacctc ccacatccag ctcatcgaac gcctcatcaa agccgggcac      2100
     atcaccgaac ccctgtgtat ccacgactcc tggaccgggc gtgccaacga gagcctcttc      2160
     cagcacttct acaaggaagc ccggcgcgcc cgaaccgaac tcgtcgacgc cggcgcaccc      2220
     tacgaccagt acaaacgccg gctgtccatc gcgctgcgtc tgctgtggcc caagggcgac      2280
     acggtgaagt cccccttctg gcggccagac tggcgcatga gtgtcgtcgc ggaagcatcc      2340
     gtccggcact gggtcaccgc gtggaaggca gtccaggccg ggcacaccct gatcgccctg      2400
     cgcaacgtcg acgaggcggt cttccacacc cctgacggca cagcgcccga cacctacaag      2460
     gtcggcaccg gcttcggcga ggtcaaggtc aagcacggtc aggagagctc ctga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page