(data stored in ACNUC7421 zone)

EMBL: AP009493.PE99

AP009493.PE99        Location/Qualifiers
FT   CDS_pept        98941..99441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SGR_99t"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_99t"
FT                   /db_xref="EnsemblGenomes-Tr:BAG16928"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNA5"
FT                   /protein_id="BAG16928.1"
FT                   /translation="MNTARLEGWANELKVLVAEDAAQECEAAQRLDAAARLMEAAQEDA
FT                   DIAADKARSSRNALAMVTEQIRRSLPDSGEADADPGAAERQQENPAPHAPSSVAGVILS
FT                   FLRNQSEATYGEITNQVRRMRPDVVAENCARDLGRLVNRGLLVRPRLGVYRLAGTQDEP
FT                   MNS"
     atgaacactg cgaggctcga aggctgggca aacgagctga aggtgttagt cgccgaggat        60
     gcagcgcagg agtgcgaggc ggcgcagcgc ctggacgcgg ccgcacgcct gatggaggct       120
     gctcaggagg acgcggacat cgccgctgac aaagcgagaa gttcacgcaa tgccctcgcg       180
     atggtcactg agcagattcg aaggtctctc cccgactccg gggaagccga tgctgacccg       240
     ggtgctgccg agcgccagca ggagaatccg gcgcctcatg ccccgagcag cgtcgccggc       300
     gtgattctct ccttcctccg caaccagagc gaggcgacct acggtgagat cacgaaccag       360
     gtgcggcgga tgcgtccgga cgtcgtcgcg gagaactgtg ctcgggacct gggccggttg       420
     gttaaccggg ggcttctggt acgccctcgg ctcggcgtgt accgactcgc tggcacccag       480
     gacgaaccaa tgaactccta a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page