(data stored in ACNUC7421 zone)

EMBL: AP009493.TEBC

AP009493.TEBC        Location/Qualifiers
FT   CDS_pept        704021..704488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tebC"
FT                   /locus_tag="SGR_604"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17433"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL5"
FT                   /protein_id="BAG17433.1"
FT                   /translation="MADARPYYELRHLVGFEETNLVGNVYYVNYVRWQGRCREMFLLDR
FT                   APEVLDDIRDDLKLFTVSVGCEFFAEITAFDQLSIRMRLEELTQTQIVFTFDYLRLHED
FT                   TENLVARGRQRVACMRGPNGDTRPTRVPEALRQALEPYAARVSAAVPASGG"
     atggccgacg cgcggcccta ctacgaactg cgtcatctcg tcggattcga ggagaccaac        60
     ctggtcggca acgtctacta cgtcaactac gttcgctggc aggggcggtg ccgggagatg       120
     ttcctgctgg acagggcacc cgaggtgctc gacgacatcc gcgacgacct gaagctgttc       180
     accgtctcgg tggggtgcga gttcttcgcc gagatcaccg ccttcgacca gctctccatc       240
     cggatgcgac tggaggagct gacgcagacg cagatcgtct tcaccttcga ctacctgcgg       300
     ctgcacgagg acaccgagaa cctggtggcc cggggccggc aacgggtcgc ctgtatgcgc       360
     ggcccgaacg gcgacacccg tcccaccagg gtgcccgaag ccctgcggca ggccctggaa       420
     ccgtacgccg cacgggtgtc ggccgcggtt cccgcgagcg gaggctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page