(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBL1

AP009493.UNBL1       Location/Qualifiers
FT   CDS_pept        704642..705625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbL1"
FT                   /locus_tag="SGR_605"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17434"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL6"
FT                   /protein_id="BAG17434.1"
FT                   /translation="MASAMGSLRRLLMAPSLRDVSFAGRGFPVTETAATRQLETIPQAV
FT                   VTGFEWGIESTSLWETERRLSLVDLEMQGFAYEGAVMASVIRDSMPGRGGRTRALLQGS
FT                   GRRHIFLNYIGIGFAMAKLPRPLWGKVMPDDLDGEEFYPPMSWLAIDGYGFDRAYFDRA
FT                   RWVDAQRPDTPYAWEGHPHYFQRAVDQGIGRALWFIHGAGVAQVSAAVRGFAPERAPDL
FT                   WAGVGLAATFAGCSTAAELASLRAESGELRGHVAQGSVFAAKARHFSGVVPEHTRAALH
FT                   ALAGITVEAAAALADDTAPAPGSARDVPAYEIWRRTVRAQLLAPTD"
     atggcatcgg caatgggttc tctgcgcaga cttctgatgg ccccttccct gcgtgacgtg        60
     agcttcgccg gacggggatt ccccgtgacc gagaccgctg ccaccagaca gctggagacc       120
     atcccgcagg ccgtggtgac cggcttcgaa tggggcatcg agtccacgag cctgtgggag       180
     accgagcggc ggctgtcgct ggtcgacctg gagatgcagg gcttcgcgta cgagggcgcg       240
     gtcatggcgt cggtcatccg ggactcgatg cccggccgcg gcggacgcac ccgggcactg       300
     ctccagggga gcgggcggcg gcacatcttc ctcaactaca tcggcatcgg cttcgccatg       360
     gccaagctgc cccggccgct gtggggaaag gtcatgcccg acgatctcga cggcgaggag       420
     ttctacccgc cgatgagctg gctcgccatc gacgggtacg gcttcgaccg cgcctacttc       480
     gaccgtgccc gctgggtcga cgcccagcgt ccggacactc cctacgcctg ggaggggcat       540
     ccgcactact tccaacgggc ggtggaccag ggcatcggac gggccctgtg gttcatccac       600
     ggcgcgggcg tcgcgcaggt cagcgccgcc gtgcgcggct tcgcccccga gcgtgcgccg       660
     gacctgtggg cgggcgtggg actcgccgcc accttcgcgg gctgctccac ggccgccgaa       720
     ctggcgtcgc tgcgcgccga gtccggggaa ctgaggggcc acgtggcgca ggggtccgtc       780
     ttcgcggcga aggcccgcca cttctccggc gtcgtgcccg agcacacccg ggccgcgctc       840
     cacgcgctgg ccgggatcac cgtcgaggcc gcggccgcgc tcgccgacga caccgcgccc       900
     gcgccgggct cggcgaggga tgtcccggcc tatgaaatct ggcgccgcac ggtgcgtgca       960
     caactgctcg cgcctaccga ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page