(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBL2

AP009493.UNBL2       Location/Qualifiers
FT   CDS_pept        705717..706685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbL2"
FT                   /locus_tag="SGR_606"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17435"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL7"
FT                   /protein_id="BAG17435.1"
FT                   /translation="MSILRAMRRRVLTPNVRETKLEKRGFHVKNAAAKHQLETVGTSFL
FT                   QGYAYAVEARTADQATDWLETVPRPFRGFAYEGAGMGAVMLDSLTGGDKRLTGILEGRG
FT                   RHHNYMIYVGVGWAMARLPRFMWPDVSSTDPVLRWLLLDGYGFHQAYFKTDAYVRDPGR
FT                   EHPFTWKGGPDAYSARVIDQGIGRALWFVGGTDPDVVAELIGAYPAHRHGDMYAGAGLA
FT                   CTYAGSVDEDELRRFAKHAGEHLPNLAQGSAFACEARERAGTTTAHTHLAARVLCGGRT
FT                   PGEAARVCADTAPESCDGGEIPAFEIWRQHIAAEITSVPHA"
     atgtccatct tgcgtgcgat gaggcgccga gtcctcacgc caaatgttcg ggaaacgaaa        60
     ctggaaaaac gcggtttcca cgtcaagaac gcggcggcca aacaccagtt ggaaacggtc       120
     gggacgagct tcctccaggg ctacgcctac gcggtcgagg cgcgcaccgc ggaccaggcg       180
     accgactggc tggagacggt tccccggccc ttccgcgggt tcgcgtacga gggcgccggc       240
     atgggcgccg tcatgctcga ctccctgacg ggcggcgaca agcggctgac cggcatcctg       300
     gagggcaggg gccggcacca caactacatg atctacgtcg gcgtcggctg ggcgatggcc       360
     aggctgccga ggttcatgtg gcccgacgtg agcagcaccg atccggtgct gcgctggctg       420
     ctcctggacg ggtacggctt ccaccaggcg tacttcaaga ccgacgccta cgtccgcgac       480
     cccggccggg aacacccttt cacctggaag ggcgggccgg acgcctacag tgcccgcgtg       540
     atcgaccagg gcatcgggcg cgccctgtgg ttcgtcggcg gtaccgaccc cgacgtcgtc       600
     gccgagctca tcggggccta ccccgcccac cgtcacggcg acatgtacgc cggcgccgga       660
     ctcgcctgca cctacgcggg cagcgtcgac gaggacgaac tgcggcgctt cgccaaacac       720
     gcgggcgagc atctcccgaa cctggcgcag ggctccgcgt tcgcctgcga ggcccgcgag       780
     cgcgcgggca cgacgaccgc ccacacccat ctcgccgccc gcgtcctgtg cggcggccgg       840
     acacccgggg aagccgcccg ggtgtgcgcc gacacggcgc ccgagagctg tgacggcggc       900
     gagatcccgg cattcgaaat ctggcggcag cacatcgccg cagagatcac ttccgttccg       960
     cacgcgtag                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page