(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBU

AP009493.UNBU        Location/Qualifiers
FT   CDS_pept        708626..709780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbU"
FT                   /locus_tag="SGR_608"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17437"
FT                   /db_xref="GOA:B1VRL9"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL9"
FT                   /protein_id="BAG17437.1"
FT                   /translation="MTVPETRTRAAAAPRHDVKVVTALRRFAISISILNIAGYTFLGFE
FT                   QPWLWPFIAVLTAYTVEIALEAVSARGEKRAPRYAGGGFKGMVEFLFPAHITGLAVNML
FT                   TYVNDRVWVMVFGVVVAVGTKWVLRAPLKGRMRHYMNPSNFGIAVILLLFPWASIAPPY
FT                   HFTEYLYGPADWVLPAIILVLGTMLNAKLTGRMWLIGAWLIGFVLQAVIRGLVTGTSIP
FT                   AALGMMTGVAFILFTNYMVTDPGTSPSRRSSQIAFGGGVAAMYGVLTALGIAYGIFFAT
FT                   ALVCLIRGGYLWGLHVKAKQAPAAAEPAQRAQAQRAQAEPAEQTAASAPPPLPTPAPEP
FT                   EPAHAATVAAARTGDPCRDGTCLHGKCASMRAAAQQRKKMAVPV"
     gtgaccgtgc ccgaaaccag gacgcgcgcg gcagccgcgc cgcggcacga cgtgaaggtc        60
     gtcaccgccc tgcgtcggtt cgcgatctcg atctcgatcc tcaacatcgc cgggtacacc       120
     ttcctcggct tcgaacagcc ctggctgtgg ccgttcatcg cggtcctcac cgcctacacg       180
     gtggagatcg cgctggaggc cgtcagcgcc cgcggagaga agcgggcccc ccgctacgcg       240
     ggcggcggtt tcaagggcat ggtcgagttc ctcttccccg cgcacatcac cggtctcgcc       300
     gtgaacatgt tgacgtacgt caacgaccgc gtctgggtca tggtcttcgg cgtcgtcgtg       360
     gccgtcggca ccaaatgggt gctccgcgcc ccgctcaagg gccgcatgcg gcactacatg       420
     aacccgtcga acttcggcat cgcggtcatt ctgctgctct tcccctgggc cagcatcgcc       480
     ccgccctacc acttcaccga gtacctgtac ggccccgccg actgggtcct tccggcgatc       540
     atcctggttc tgggcaccat gctgaacgcg aagctgacgg gccgtatgtg gctgatcggc       600
     gcctggctga tcgggttcgt cctccaggcg gtcatccgcg gcctggtgac ggggacctcc       660
     atcccggcgg cgctcggcat gatgaccgga gtggcgttca tcctcttcac gaactacatg       720
     gtcaccgacc ccggcacctc cccctccagg cgttcctccc agatcgcctt cggcggcggc       780
     gtcgccgcga tgtacggggt gctcacggcg ctcggcatcg cgtacggcat cttcttcgcc       840
     accgccctgg tctgcctgat ccgcggcggc tacctgtggg gcctgcacgt caaggccaag       900
     caggctccgg ccgcggccga accggcacag cgggcccagg cacagcgggc ccaggcggag       960
     cccgcggagc agaccgccgc ctccgctccc cctcccctgc ccactcccgc ccccgagccg      1020
     gagccggcac acgcggccac ggtggcggct gcccgcaccg gcgacccgtg ccgggacggc      1080
     acctgcctcc acggcaagtg cgcgtccatg cgggccgcgg cgcagcagcg gaaaaagatg      1140
     gcggtgcccg tatga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page