(data stored in ACNUC7421 zone)

EMBL: AP009493.UNBV

AP009493.UNBV        Location/Qualifiers
FT   CDS_pept        706698..708629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="unbV"
FT                   /locus_tag="SGR_607"
FT                   /product="putative enediyne biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17436"
FT                   /db_xref="InterPro:IPR011519"
FT                   /db_xref="UniProtKB/TrEMBL:B1VRL8"
FT                   /protein_id="BAG17436.1"
FT                   /translation="MTHPISWLRKQAPGVIALALMVSTFYVVKPYESSAADKAELAEKF
FT                   TFEPMAISMPGGYRKQSVRKVNKAYKHIEAWISSVGAGVAMNDIDGDGLPNDLCITDPQ
FT                   IDQAVVTPAPAPGRESASYAPFTLDMSPLPKSDIMAPIGCVPGDYNEDGAMDLLVYYWG
FT                   RTPVIFQAKKEPGKDTTTMDPKCFEPVELVPGNGGGGEYDGPLWNSNAATVADFDGDGH
FT                   NDIYIGNYFPDSPVLDDTVHGGVTMNDSLSHAQNGGGGHFFRWTPSGYEQVEGVLPKGI
FT                   DQGWTLAVSATDLDGDQRPEMYLAHDFGTSALLYNRSTPGTFKFSEVKAKHTATTPKSK
FT                   EIGRSSFKGMGIDFGDLDNDGLYDAFVSNITTSFGIQESNFAFIGTARDKADLRAKFRD
FT                   GVAPYKDESAPLNLAWSGWGWDVKMGDFDNDGIQEITQAVGFVKGKRNRWAQLQELATA
FT                   NDALVKHPRFWPRVEEGDDLAGDQHMRFFVQEKDGEAYSDLSKQLGLAVPVPSRGIATG
FT                   DADGDGRLDMVVARQWEDPVFYCNMSRKTGGHLNLSLTDAAGSPVIGAQVTVTLSDGST
FT                   RLGRVDGGSGHSGKRSQDVHIGLGQEAEGPMQTRLTWRDRTGQVRNKDLQLTPGRHALE
FT                   LGADVKEK"
     atgacacacc cgatttcctg gctgcggaag caggcgcccg gagtcatcgc actcgctctc        60
     atggtcagca ccttttacgt ggtgaagccg tacgagtcga gtgctgccga caaagcggag       120
     ctggcggaga agttcacctt cgagccgatg gcgatatcca tgccgggcgg ctaccggaaa       180
     cagagcgtcc gcaaggtgaa caaggcctac aagcacatcg aggcgtggat ctcctccgtc       240
     ggcgcgggcg tcgccatgaa cgacatcgac ggcgacggcc tgcccaacga cctgtgcatc       300
     accgacccgc agatcgacca ggcggtggtc acccccgcac cggcgcccgg tcgcgagagc       360
     gcctcgtacg cgccgttcac cctggatatg tctccgctgc ccaagagcga catcatggcc       420
     ccgatcggct gcgtccccgg tgactacaac gaggacggcg cgatggacct gctcgtgtac       480
     tactggggcc gtaccccggt gatcttccag gcgaagaagg agcccggcaa ggacaccacg       540
     accatggacc cgaagtgctt cgagcccgtc gagctcgtcc ccggcaacgg cggtggcggg       600
     gagtacgacg ggccgctgtg gaactccaac gccgcgacgg tcgccgactt cgacggtgac       660
     gggcacaacg acatctacat cgggaactac ttccccgaca gccccgtcct ggacgacacc       720
     gtgcacggcg gcgtgacgat gaacgactcg ctgtcccacg cccagaacgg cggcggcggt       780
     cacttcttcc gctggacccc ctccggctac gaacaggtcg agggcgtcct gccgaagggc       840
     atcgaccagg gctggaccct ggccgtctcg gccaccgacc tggacgggga ccagcgcccc       900
     gagatgtacc tcgcgcacga cttcgggacg tcggcccttc tgtacaacag gtcgaccccc       960
     ggcaccttca agttcagcga ggtcaaggcc aagcacaccg cgaccactcc gaagtccaag      1020
     gagatcggcc gcagctcctt caagggcatg ggcatcgact tcggcgatct ggacaacgac      1080
     ggcctctacg acgccttcgt ctccaacatc acgacctcct tcggcatcca ggagtccaac      1140
     ttcgccttca tcggaacggc ccgtgacaag gccgacctgc gcgccaagtt ccgcgacggc      1200
     gtcgccccct acaaggacga gagcgcaccg ctcaacctcg cctggtccgg atggggctgg      1260
     gacgtgaaga tgggcgactt cgacaacgac ggaatccagg agatcaccca ggccgtcggc      1320
     ttcgtcaagg gcaagcgcaa ccgctgggcg cagctccagg agctcgccac cgccaacgac      1380
     gcgctggtca agcacccccg cttctggccc cgcgtggagg agggcgacga cctcgccggc      1440
     gaccagcaca tgcgcttctt cgtccaggag aaggacggcg aggcctacag cgacctgtcc      1500
     aagcagctcg gtctggccgt accggtgccc agccggggca tcgccaccgg cgacgccgac      1560
     ggcgacggac gcctcgacat ggtcgtggca cgccagtggg aggaccccgt cttctactgc      1620
     aacatgagcc ggaagaccgg cggccacctg aacctcagcc tcaccgacgc ggccggctcg      1680
     cccgtcatcg gcgcccaggt caccgtgacc ctctccgacg gcagcacccg tctgggccgg      1740
     gtcgacggcg gcagcggcca ctccggcaag cgcagccagg acgtgcacat cggcctcggc      1800
     caggaggccg aggggccgat gcagacccgc ctgacctggc gtgaccgcac cgggcaggtg      1860
     cgcaacaagg atctccagct gacccccggc cggcacgcgc tggaactcgg cgccgacgtg      1920
     aaggagaagt ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page