(data stored in ACNUC7421 zone)

EMBL: AP009493.UREA3

AP009493.UREA3       Location/Qualifiers
FT   CDS_pept        complement(254882..255184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA3"
FT                   /locus_tag="SGR_238"
FT                   /product="putative urease gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17067"
FT                   /db_xref="GOA:B1VNP4"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP4"
FT                   /protein_id="BAG17067.1"
FT                   /translation="MFLTPSDTEKLLLSVAGMIARDRRARGVRLNYPETVALLACWAME
FT                   RAREGAPVSELMTAGRSVLTRAEVLEGVPEMLHDVQVEATFPDGRKLVTITSPIP"
     atgtttctga ctccgtccga cacggagaaa ttgctactga gtgttgccgg aatgatcgcc        60
     cgtgaccgac gtgcccgcgg cgtccgcctc aactacccgg agaccgtcgc cctgctcgcg       120
     tgctgggcga tggagcgggc ccgcgaggga gccccggtca gcgagctgat gactgccggc       180
     aggtccgtcc tcacccgtgc tgaagtgctg gaaggcgtcc ctgagatgct gcacgacgtc       240
     caggtcgagg cgaccttccc ggacgggcgc aagctcgtca cgatcacctc gccgatcccg       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page