(data stored in ACNUC7421 zone)

EMBL: AP009493.UREC3

AP009493.UREC3       Location/Qualifiers
FT   CDS_pept        complement(252842..254545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC3"
FT                   /locus_tag="SGR_236"
FT                   /product="putative urease alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17065"
FT                   /db_xref="GOA:B1VNP2"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP2"
FT                   /protein_id="BAG17065.1"
FT                   /translation="MAQLTRAAYASLYGPTTGDRIRLADTDLWIEVEEDRCFGGDEAVF
FT                   GGGKSIRESMAQATASRAEGAPDLVITNAVVLDHWGVVKTDVGVRDGRIVALGRSGNPD
FT                   ISDGVHPDLVIGPGTDVISGEGRILTAGAVDTHVHFLMPETLHEALATGTTTVIGGGTG
FT                   ATEGSKATTVTPGAWNLAMMHRSLDRVPLNVMLFGKGSTVGEEALREAALSGAGGYKVH
FT                   EDWGATPAAIDAALRAADAYGLQVALHADSLNEVGYVEGTLDAIAGRGIHVFHAEGAGG
FT                   GHAPDIITVASHPNILPASTNPTLPHTVNTVAEHLDMLMVCHHLNPRVPEDLAFAESRI
FT                   RATTIAAEDVLHDIGALSITSSDAQAMGRIGEVVCRTWQVAHVMKQRFGDRDSELPADN
FT                   ERARRYVAKYTICPAVAHGIDHVVGSVEPGKLADLVLWDPAFFGIRPAAVIKGGMAVYA
FT                   PLGDAGAAIPTTQPVLLRATSAAEAAPHLSVSFVSPLALADGLAERLGLERELVAIRPT
FT                   RHLTKADLPNNTALPAIDVDPETFAIRIDGELVEPAPAAELPLAQRYSMF"
     atggcccagc tgacccgcgc cgcctacgcg tcgctctacg gccccaccac cggggaccgg        60
     atccgcctcg ccgacaccga cctctggatc gaggtggagg aggaccggtg cttcggcggc       120
     gacgaagccg tcttcggagg cggcaagtcc attcgcgagt cgatggccca ggccaccgcg       180
     tcccgcgccg agggcgcccc cgacctggtc atcaccaacg ccgtcgtcct ggaccactgg       240
     ggcgtcgtca agaccgacgt cggtgtccgc gacgggcgga tcgtcgccct cggccgctcc       300
     ggcaaccccg acatcagcga cggcgtgcac ccggacctgg tgatcggccc gggcaccgac       360
     gtgatctccg gcgaggggcg catcctcacc gccggagccg tcgacaccca cgtccacttc       420
     ctgatgccgg agaccctcca cgaggcgctc gccaccggca ccaccaccgt catcgggggc       480
     ggcaccggcg ccaccgaggg ctccaaggcc accaccgtca cccccggcgc ctggaacctc       540
     gccatgatgc accggtccct ggaccgcgtc ccgctcaacg tcatgctgtt cggcaagggt       600
     tccaccgtcg gcgaggaagc cctgcgcgag gcggccctca gcggcgccgg cggctacaag       660
     gtccacgagg actggggcgc caccccggcc gcgatcgacg ccgcgctgcg ggcggccgac       720
     gcctacggcc tccaggtggc gctgcacgcg gacagcctca acgaggtcgg ctacgtcgag       780
     ggcaccctgg acgccatcgc cggacgcggc atccacgtct tccacgccga gggcgcgggc       840
     ggcggccacg ctcccgacat catcaccgtg gcctcacacc ccaacatcct ccccgcgtcc       900
     accaacccga cgctcccgca caccgtcaac accgtcgccg agcacctcga catgctgatg       960
     gtgtgccacc acctcaaccc ccgggtcccc gaggacctcg cgttcgccga gtcccggatc      1020
     cgggccacca ccatcgccgc cgaggacgtg ctgcacgaca tcggcgcact ctccatcacc      1080
     tcctccgacg cccaggcgat gggccgcatc ggcgaggtcg tctgccgcac ctggcaggtc      1140
     gcccacgtca tgaagcagcg tttcggcgac cgcgacagcg aactgcccgc cgacaacgag      1200
     cgggcgcgcc ggtacgtcgc caagtacacg atctgcccgg ccgtcgccca cggcatcgac      1260
     cacgtcgtcg gctccgtgga gcccggcaag ctcgccgacc tggtgctctg ggaccccgcc      1320
     ttcttcggga tccggcccgc cgccgtcatc aagggcggca tggccgtgta cgcgccgctc      1380
     ggcgacgcgg gcgcggcgat ccccaccacc cagccggtcc tcctgcgcgc cacctccgcc      1440
     gccgaggccg cgccgcacct ctcggtcagc ttcgtctccc cgctggccct ggccgacgga      1500
     ctggccgaac gactcggcct cgaacgcgag ttggtggcca tacgccccac ccggcatctc      1560
     accaaggcgg acctgccgaa caacacggcg ctcccggcca tcgacgtgga ccccgagacc      1620
     ttcgccatcc gcatcgacgg ggagctcgtc gagcccgccc ccgccgccga actgccgctg      1680
     gcccagcggt acagcatgtt ctga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page