(data stored in ACNUC7421 zone)

EMBL: AP009493.URED3

AP009493.URED3       Location/Qualifiers
FT   CDS_pept        complement(250668..251435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD3"
FT                   /locus_tag="SGR_233"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17062"
FT                   /db_xref="GOA:B1VNN9"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VNN9"
FT                   /protein_id="BAG17062.1"
FT                   /translation="MTGPPAPAARPAEPDDPTVVAVERDASGRHLARELSPGAFLAPRP
FT                   LLPCADRLRIALVGTRAGLLAGDDLRLHVSVGPGARLDLVEPSGLVAYDHRGGRSAWRA
FT                   RIDIAAGGRLDWDGKPFVVAHGAWVDRTMEVTLAPGARMLWRDTLVLGRSGERGGRVRT
FT                   RTRAEYDGRELLVEDLDLTDPDIRELPGVLGPNRIVGSVTALGTRPPGPPHPYRTDLAG
FT                   PGAQVRLLDTEAPAMEAELSALCEHWRTENDHA"
     gtgaccggcc cgcccgcgcc cgccgcacgc ccggccgagc ccgacgaccc cacggtcgtc        60
     gccgtcgagc gcgacgcctc cggccggcac ctcgcccgcg agctctctcc cggggcgttc       120
     ctcgcccccc gccccctgct gccgtgcgcg gaccgcctgc ggatcgccct cgtgggcacc       180
     cgggccggac tgctggccgg cgacgatctc cggctgcacg tgtccgtcgg cccgggggcc       240
     cgcctggatc tggtcgagcc ctccggtctg gtggcctacg accaccgggg aggcagatcg       300
     gcgtggcggg ccaggatcga catcgcggca ggaggccgtc tggactggga cggaaagccg       360
     ttcgtggtcg cgcacggcgc gtgggtcgac cgcaccatgg aggtgacgct cgcgcccggc       420
     gcccggatgc tgtggcgcga caccctcgtc ctgggccgct ccggtgaacg cggcgggcgg       480
     gtccggacca ggacgagggc cgagtacgac ggccgggaac tgctggtaga ggacctcgac       540
     ctgaccgacc cggacatccg ggagctaccc ggtgtgctcg gcccgaaccg gatcgtcggc       600
     tccgtcaccg ccctcggcac ccgtccgccc ggaccgcccc acccctaccg gacggacctc       660
     gcgggccccg gggcccaggt ccggctgctg gacaccgagg cgccggcgat ggaagcggaa       720
     ctgtcggccc tgtgcgagca ctggcgcacc gagaacgacc acgcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page