(data stored in ACNUC7421 zone)

EMBL: AP009493.UREF3

AP009493.UREF3       Location/Qualifiers
FT   CDS_pept        complement(252177..252842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF3"
FT                   /locus_tag="SGR_235"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17064"
FT                   /db_xref="GOA:B1VNP1"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:B1VNP1"
FT                   /protein_id="BAG17064.1"
FT                   /translation="MALLAPYLLADGRLPVGAHTYSAGLEPAVAAGLTRAQIPALLRAR
FT                   LHTTVVTEAAATALALRAALRAPVDFAPVQEALAARTPTAPLREASAALGRGVHRLARR
FT                   LDPDHPAVTALARIRPRPLRPVTLGALGAVLGVGEEELVHGVVYDELQTIASAALKLLP
FT                   GDPLDSVAWIVAAEADAARTVTEALAVRTPAELPARTPPLTEQWALEHDRRERRLFLA"
     atggcgctgc tcgcccccta cctcctcgcc gacgggcggc tcccggtcgg cgcccacacc        60
     tacagcgccg gcctcgaacc ggccgtcgcg gcaggcctca cgcgcgcgca gatacccgcg       120
     ctgctgaggg cccgcctgca caccaccgtc gtcaccgaag cggctgccac cgcactcgcc       180
     ctgcgcgcgg ccctgcgcgc accggtggac ttcgcgcccg tgcaggaggc actcgccgcc       240
     cggacgccga cggcgccgct gcgcgaggcg tccgccgccc tgggccgagg cgtgcaccgc       300
     ctcgcccgtc gactggaccc ggaccatccc gcggtcaccg ccctggcgcg gatccggccg       360
     cgccccctgc gaccggtcac cctcggggcg ctcggggccg tcctgggggt gggggaggag       420
     gagctggtcc acggcgtcgt ctacgacgaa ctccagacca tcgcctccgc cgcgctcaaa       480
     ctgctgcccg gcgaccccct cgactcggtc gcgtggatcg tcgccgccga agcggacgcc       540
     gcgagaaccg tcaccgaggc gctggccgta cgcacccccg ccgaactccc cgcccgtacc       600
     ccaccgctca ccgagcagtg ggcacttgaa cacgaccgac gcgaacggag actcttcctt       660
     gcctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page