(data stored in ACNUC7421 zone)

EMBL: AP009493.UREG3

AP009493.UREG3       Location/Qualifiers
FT   CDS_pept        complement(251432..252184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG3"
FT                   /locus_tag="SGR_234"
FT                   /product="putative urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SGR_234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG17063"
FT                   /db_xref="GOA:B1VNP0"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1VNP0"
FT                   /protein_id="BAG17063.1"
FT                   /translation="MPDNASAQQPGQPAQGPNEHYHQPLNQPRALRIGVAGPVGTGKSS
FT                   ILATLCRELAGELSMAVVTNDIYTDEDARFLRSAGVLPTERIRAVETGACPHTAIRDDV
FT                   SANLDAVEDLEEAYGPLDLVLIESGGDNLTATFSPALADAQLFSIDVAGGGDVARKGGP
FT                   GITGADLLVINKTDLAPHVEVDVTAMVADAERARDGLPVLALSKHDPESIARLADWVRA
FT                   VLVRHRSGTHVPTDPGPMAPHSHSHDGS"
     ttgcctgaca acgcatccgc ccagcagccg ggacagcccg cccagggccc caacgagcac        60
     taccaccagc cgctcaacca gccgcgcgcc ctgcgcatcg gcgtcgccgg ccccgtcggc       120
     accggcaaga gctccatcct cgccaccctc tgccgcgaac tcgccggtga actctccatg       180
     gccgtcgtca ccaacgacat ctacaccgac gaggacgccc gcttcctccg ctcggccggc       240
     gtcctgccca ccgagcgcat ccgcgccgtc gagaccggcg cctgcccgca caccgcgatc       300
     cgcgacgacg tcagcgccaa cctcgacgcg gtcgaggacc tggaagaggc gtacgggcca       360
     ctggacctgg tgctcatcga gagcgggggc gacaacctca ccgccacctt cagcccggcc       420
     ctcgccgacg cccagctgtt cagcatcgac gtcgcgggcg gcggggacgt cgcccgcaag       480
     ggcggcccgg gcatcaccgg cgcggacctc ctggtcatca acaagaccga cctggccccc       540
     catgtggagg tcgacgtcac cgcgatggtc gccgacgccg aacgggcccg cgacggtctg       600
     cccgtcctcg cgctgtccaa gcacgatccg gagtcgatcg cccgactggc cgactgggtg       660
     agggccgtgc tggtacgcca ccgctccggc acccacgtcc cgaccgaccc cggcccgatg       720
     gcgccccaca gccacagcca cgacggctcg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page