(data stored in ACNUC7421 zone)

EMBL: AP010803.ACPS

AP010803.ACPS        Location/Qualifiers
FT   CDS_pept        complement(670743..671144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="SJA_C1-06660"
FT                   /product="holo-[acyl-carrier-protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95500"
FT                   /db_xref="GOA:D4YYR8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR8"
FT                   /protein_id="BAI95500.1"
FT                   /translation="MIVGLGSDLCNIERIENSLDRFGERFEKRVFTDVEQAKANRRPFT
FT                   KAGTLAKRFAAKEAFSKAVGTGFKQGVFMKDIGVVNGPSGAPTLHLTGGALARLESLVP
FT                   AGHRPVVHLTLTDDHPWAQAFVIIEALPL"
     ttgatcgtcg gcctgggttc cgacctctgc aatatcgagc gaatcgagaa ttcgctcgac        60
     cgtttcggcg agcggttcga aaagcgcgtg ttcaccgatg tcgaacaggc caaggccaat       120
     cgccgtccct tcaccaaggc gggcacgctc gccaagcgct tcgccgccaa ggaggcgttt       180
     tcgaaggccg tcggcaccgg gttcaagcag ggcgtgttca tgaaggacat cggcgtcgtc       240
     aatggcccca gcggcgcgcc gacgctgcat ttgacgggcg gagcgctggc ccggctggaa       300
     tcgctggttc ccgcggggca ccggccggtc gttcacttga cgctcaccga cgatcatcca       360
     tgggcgcagg cctttgtgat tatcgaagcc ctgccgttat aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page