(data stored in ACNUC7421 zone)

EMBL: AP010803.ADK

AP010803.ADK         Location/Qualifiers
FT   CDS_pept        654683..655348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SJA_C1-06480"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95482"
FT                   /db_xref="GOA:D4YYQ0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ0"
FT                   /protein_id="BAI95482.1"
FT                   /translation="MRDMNIILLGPPGAGKGTQATRLVDSRAMVQLSTGDMLRAAVKAG
FT                   TPIGLKAKAVMEAGELVSDEIVSGIIGEALDALAPETGVIFDGYPRTEAQAHSLDGILA
FT                   DRNRTLDHVIELEVDEDALVERITGRFTCATCGEGYHDRFKTPKVEGACDKCGGHEFKR
FT                   RPDDNEETVRTRMAEYRAKTAPILPIYEARGIVSRVDGMADMDDVTVAIAAILDGKAA"
     atgcgcgaca tgaatatcat tctgctcggc cctccgggcg ccggcaaggg aacgcaggcg        60
     acgcgcctgg tggacagccg ggccatggtg caactgtcga ccggcgacat gctgcgcgcg       120
     gcggtgaagg ccgggacgcc catcggcctc aaggccaagg cggtgatgga ggccggcgag       180
     ctggtgtccg acgagatcgt ctccggcatc atcggggagg cgctggacgc cctggctccg       240
     gaaaccggcg tgatcttcga cggctatccc aggacggagg cgcaggcgca ttcgctggac       300
     ggcatattgg ccgaccgcaa ccggacgctg gaccatgtga tcgaactcga agtggacgag       360
     gatgcgctgg tcgagcgcat caccggccgc ttcacctgcg cgacctgcgg cgagggctat       420
     cacgacaggt tcaagacgcc gaaggtcgag ggcgcctgcg acaaatgcgg cggccatgaa       480
     ttcaagcgcc gtccggacga caatgaggaa accgtgcgga cccgcatggc cgaatatcgc       540
     gccaagacag cgcccatcct gccgatctac gaagcgcgcg gcatcgtgtc gcgggtcgac       600
     ggcatggccg acatggacga tgtgacggtc gctatcgccg ccatattgga cggcaaggcc       660
     gcctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page