(data stored in ACNUC7421 zone)

EMBL: AP010803.ARGB

AP010803.ARGB        Location/Qualifiers
FT   CDS_pept        complement(684565..685482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="SJA_C1-06840"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95518"
FT                   /db_xref="GOA:D4YYT6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT6"
FT                   /protein_id="BAI95518.1"
FT                   /translation="MRPRMNSKHSPDPALLAKAETLVEALPYMQRYAGKTFVVKYGGHA
FT                   MGDPEAARDFAEDVVLMKAVGINVVVVHGGGPQIGAMLKKLGVESQFVGGLRVTDKETA
FT                   QIAEMVLAGSINKEIVGWISGAGGRAVGISGKDGGLVLCEKVLGKREADPNSGIERNVD
FT                   LGFVGDPVRVDRSILDTLTQNGIIPVVAPVGIGADGHTYNVNADTMAGAIAAELQAARF
FT                   FLLTDVAGVLDKQGQLLTDLDPEAINGLEADGTISGGMIPKLETCVRAVEGGVDAAVIL
FT                   DGRVPHAMLLEIFTDRGAGTLVRR"
     atgcgcccgc gcatgaacag caagcactcc cccgatccgg cgctcctcgc caaggccgaa        60
     accctcgtcg aggcattgcc ctatatgcag cgatatgcgg gcaagacctt cgtcgtgaaa       120
     tatggcggcc acgccatggg cgatccggag gcggcccgcg atttcgcgga agatgtcgtg       180
     ctgatgaagg cggtcggcat caatgtcgtc gtcgtccatg gcggcggccc gcagatcggc       240
     gcgatgctca agaagctggg cgtcgaatcg cagttcgtcg gcggcctgcg cgtcaccgac       300
     aaggaaaccg cgcagatcgc ggaaatggtc ctggccggtt ccatcaacaa ggagatcgtc       360
     ggctggatct ccggcgctgg cgggcgcgcg gtcggcattt cgggcaagga tggcggcctg       420
     gtcctgtgcg aaaaggtgct gggcaagcgt gaggcggacc ccaattccgg catagagcgc       480
     aatgtcgacc tgggctttgt cggcgatccg gtgagggtcg accgcagcat cctggacacg       540
     ctgacccaga acggcatcat tccggtggtc gcgccggtgg gcatcggcgc ggacggacac       600
     acctataatg tcaatgccga caccatggcg ggcgccatcg cggcggaatt gcaggcggcg       660
     cgcttcttcc tcctcaccga cgtggcgggc gtgctggaca agcagggcca gttgctgacc       720
     gatctcgacc cggaggcgat caacgggctg gaggcggacg gcacgatcag cggcggcatg       780
     atcccgaagc tggaaacctg cgtccgcgcg gtcgaaggcg gggtggacgc cgccgtcatc       840
     ctggacggcc gcgtgccgca tgcgatgctg ctggaaatct tcaccgatcg cggcgcaggc       900
     accctggtgc gccgctaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page