(data stored in SCRATCH zone)

EMBL: AP010803.ARSC

AP010803.ARSC        Location/Qualifiers
FT   CDS_pept        441542..442078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="SJA_C1-04240"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95258"
FT                   /db_xref="GOA:D4YY26"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY26"
FT                   /protein_id="BAI95258.1"
FT                   /translation="MTDRLLNVLFLCTGNSARSIMAEAILSREGLGRFKSFSAGSQPKG
FT                   EVHPFTIHLLEKLNYDASRFRSKSWEEFSGPDAPSLDFVFTVCDNAANELCPVWPGQPL
FT                   TANWGVPDPAAIEDSETVQHAAFFDTYRMLFNRISLFTNLPFEGLDKMSLQNRLNRIGK
FT                   EQGRADLPSEKAPSA"
     atgacggatc gcctgttgaa cgtactgttt ctttgcacgg gcaattccgc ccgttccatc        60
     atggccgagg cgatcctcag ccgtgagggg ctaggccgtt tcaaatcgtt cagcgccggc       120
     agccagccca agggcgaggt ccatccgttc accattcatc tcttggagaa gctgaactac       180
     gacgcaagcc ggttccgctc gaagagctgg gaagagtttt ccggccccga tgcgccgtcc       240
     ttggatttcg tgttcaccgt ttgcgacaat gccgccaatg agctttgccc ggtttggccg       300
     gggcagccgc tgaccgccaa ttggggggtg cccgatccgg ccgctatcga ggacagcgaa       360
     acggtgcagc acgcggcctt ctttgatact tacaggatgc tgttcaatcg catctcgctg       420
     ttcaccaacc tgccgttcga aggcctcgac aagatgagtc tacagaaccg gctgaaccgg       480
     atcggcaagg aacagggccg cgccgacctc ccaagcgaaa aggcacccag cgcatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page