(data stored in ACNUC7421 zone)

EMBL: AP010803.ARSH

AP010803.ARSH        Location/Qualifiers
FT   CDS_pept        444007..444747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="SJA_C1-04280"
FT                   /product="arylsulfatase-family protein"
FT                   /note="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95262"
FT                   /db_xref="GOA:D4YY30"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY30"
FT                   /protein_id="BAI95262.1"
FT                   /translation="MSRLRILPEPDHMPALDRAMIRPDLAAGLGALEPKPRILLLYGSL
FT                   RERSFSRFAVEEAARLLILFGAEVRIFDPADLPLPDQIKDDDHPAVHELREHALWSEGM
FT                   VWCSPERHGQITGIMKAQIDHLPLEFGGMRPTQGRTLAVMQVSGGSQSFNAVNTLRLLG
FT                   RWMRMFTIPNQSSIAMAFKEFDEDGRLSASSYYDRIVDVMEELVRFTVLTRRHADQLVD
FT                   RYSERKAAAAKRDAAQDLASRSKA"
     atgtcgcgtc ttcgtatcct tcccgaaccc gatcacatgc ccgcgctgga ccgtgcaatg        60
     atccggcccg atctcgccgc cgggctcggc gcgcttgagc cgaaacctcg catcctcctc       120
     ctctacggct cgctgcgcga gcggtcgttc agtcgcttcg cggtcgagga agcggcccgg       180
     ctgctcatcc tcttcggcgc cgaagtgcgg atcttcgatc cggccgatct cccgctcccc       240
     gaccagatca aggacgatga tcacccggcg gtgcatgagc ttcgcgagca tgcgctttgg       300
     tccgagggca tggtctggtg cagtcccgaa cggcacggcc agatcaccgg catcatgaaa       360
     gcgcagatcg accatttgcc gctcgaattc ggcggcatgc gtccgaccca gggccggacc       420
     ctggccgtca tgcaggtttc gggcggatcg cagtcgttca acgcggtcaa cacgttgcgg       480
     ctgctcgggc ggtggatgcg catgttcacc atccccaacc agtcgagcat tgctatggcg       540
     ttcaaggagt tcgacgagga cggccgtctc agtgcctcaa gctattatga ccggatcgtc       600
     gacgtcatgg aggagctggt gcgcttcacg gtgctgacac gtcgccatgc cgatcaactc       660
     gtggaccgct attcggaacg caaggcggca gccgccaagc gcgacgcggc ccaagatctg       720
     gcctcacggt cgaaggcctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page