(data stored in ACNUC7421 zone)

EMBL: AP010803.BACA

AP010803.BACA        Location/Qualifiers
FT   CDS_pept        complement(259546..260355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SJA_C1-02430"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="undecaprenol kinase, putative / uncharacterized
FT                   bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95077"
FT                   /db_xref="GOA:D4YXJ5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ5"
FT                   /protein_id="BAI95077.1"
FT                   /translation="MDLHYLTVILLGIVEGLTEFLPVSSTGHLILASELLGYDASTWAM
FT                   FNVVIQLGAILAVVVLYWRTFWAVGMGLLRREPASWRFLRNLLVAFIPAAVIGLALHNY
FT                   IEELLGAPRVVAWALIAGGIAILGIERMVKENRFHGIADIPFVRVVGIGFIQCLAMIPG
FT                   ISRSGATIMGALTLGVERRTAAEFSFFLAIPTMLGATTLELLKNGDKLTSATVGWGSIV
FT                   LGFIVSFIVALLVIKWFVGLVSRHGFAPFAWYRIVAGIAALAWLSLR"
     atggacctgc attatctgac agtcatcctg ctcggcatcg tcgaggggct gaccgaattc        60
     ctgcccgtat cctcgaccgg ccacctgatc ctggccagcg aattgctggg ctatgacgca       120
     tccacctggg cgatgttcaa cgtcgtcatc cagttgggcg cgatcctggc ggtggtggtg       180
     ctctactggc ggaccttctg ggcagtgggc atgggcctgc tgcgccggga accggcgagc       240
     tggcgcttcc tgcgcaacct gctggtcgcc ttcatcccgg cggcggtgat cggcctggcg       300
     ctccacaatt atatcgagga attgctgggc gcgccaaggg tggtcgcctg ggcgctgatc       360
     gcgggcggca tcgcgatcct ggggatcgag cggatggtga aggaaaaccg cttccacggc       420
     attgcggaca ttcccttcgt ccgggtggtc ggcatcggct tcatccagtg cctcgccatg       480
     atccccggca tcagccggtc gggcgcgacc atcatgggcg cgctgacctt gggcgtggag       540
     cggcgcacgg cggcggaatt cagcttcttc ctcgccatcc cgaccatgtt gggggcaacc       600
     acgctggaac tgctgaaaaa cggcgacaag ctgacctccg ccacggtcgg ctggggcagc       660
     atcgtgctgg gcttcatcgt ctccttcatc gtcgcgctgc tggtgatcaa atggtttgtg       720
     gggctggtgt cgcgccatgg cttcgcgccc ttcgcctggt atcgaatcgt cgcgggaatc       780
     gcggcattgg catggctttc cctcaggtaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page