(data stored in ACNUC7421 zone)

EMBL: AP010803.BCR

AP010803.BCR         Location/Qualifiers
FT   CDS_pept        complement(76564..77838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr"
FT                   /locus_tag="SJA_C1-00730"
FT                   /product="putative MFS permease"
FT                   /note="permease of the major facilitator superfamily, DHA1
FT                   family / bicyclomycin/chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94907"
FT                   /db_xref="GOA:D4YX25"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX25"
FT                   /protein_id="BAI94907.1"
FT                   /translation="MTEHPDTAAAQPKRDMAFREFVMLCACLMAMNALSIDPMLPALPD
FT                   IGRDLSVPHPNDRQLIISVYFLGLGVGSLLFGVLSDRYGRKRVLGGAMALFILSSIACA
FT                   GAHSFAMMLAARACAGFFAGASRVITVGIVRDRFRGDAMARVMSLIFAVFMLIPVMAPT
FT                   FGQAILWIAPWRWIFWALAILATLILLWMGMRLPETLLPENRLRMSAGTIFRTVGTIVR
FT                   TRTSIGYMLASGVVMSGLIGFILSVQQIFFDIFGAQGIFPFAFAAMAGSMGVGSLLNSR
FT                   LVSRFGARRLSQTALLCLVSINVVHLAVILAGHETIVSFMILQAATMMTIAFTASNFSA
FT                   ISMEPFAKGAGVASSFQAFLTTAVSSALGSLIGQAFNGTTLPLTLGLAVFGSVSFLIVA
FT                   WAERGNLFTRPHHGALRDPEFEPLH"
     atgaccgaac atcccgacac cgccgcagca cagccgaaac gggacatggc attccgcgaa        60
     ttcgtgatgc tgtgcgcctg cctgatggcg atgaacgcgc tgtcgatcga tcccatgctg       120
     cctgccttgc ccgacatcgg ccgggatctt tcggtgccgc accccaatga ccggcaattg       180
     atcatcagcg tctacttctt gggactgggc gtcggatcgc tgctgttcgg cgtgctttcg       240
     gaccgctatg ggcggaaacg ggtgctgggc ggcgcgatgg cgctgttcat cctttcctcc       300
     atcgcctgcg cgggcgcgca cagctttgcc atgatgctgg ccgcccgggc ctgcgccggc       360
     ttcttcgcgg gcgccagccg ggtgatcacc gtcggcatcg tccgcgatcg gttccggggc       420
     gacgcgatgg cccgggtgat gtcgctgatc ttcgccgtgt tcatgctgat cccggtcatg       480
     gcgccgactt tcggccaggc gatcctgtgg atcgcgccct ggcgatggat attctgggcg       540
     ctggcgatcc tggcgacgct gatcctgttg tggatgggga tgaggcttcc ggaaacgctg       600
     ctgcccgaaa atcgcctgcg gatgagcgcg gggacgatct tccgcacggt cggcaccatc       660
     gtccgcacgc gcacgtccat cggctatatg ctggcgagcg gcgtcgtgat gagcggcctg       720
     atcggcttca tcctgtcggt gcagcagatc ttcttcgaca tattcggggc gcaggggatt       780
     tttcccttcg ccttcgcggc catggccggc agcatgggtg tcggcagcct gctcaacagc       840
     cggctcgtct cccgcttcgg cgcccggcgg ctgagccaga cggcgctgct gtgcctggta       900
     tcgatcaatg tcgtgcatct ggcggtgatc ctggcggggc atgaaaccat cgtcagcttc       960
     atgatcctgc aggcggcgac gatgatgacc atcgccttca ccgcgtcgaa tttcagcgcg      1020
     atttcgatgg agcccttcgc gaaaggcgcc ggcgtcgcat cctccttcca ggcctttctg      1080
     accacggcgg tgtcgagcgc gctgggcagc ctgatcggcc aggccttcaa cgggacgaca      1140
     ctgccgctga cattggggct ggcggtgttc ggctccgtct ccttcctgat cgtcgcctgg      1200
     gcggaacggg gcaatttgtt cacgcgcccc catcatggcg cgctgcgcga tccggaattc      1260
     gagccgctgc actga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page