(data stored in ACNUC7421 zone)

EMBL: AP010803.BDH

AP010803.BDH         Location/Qualifiers
FT   CDS_pept        complement(576850..577629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdh"
FT                   /locus_tag="SJA_C1-05660"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95400"
FT                   /db_xref="GOA:D4YYG8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG8"
FT                   /protein_id="BAI95400.1"
FT                   /translation="MMLSGKVAVITGAASGIGNDIALEFVRHGAKVVIADLQLEKAEAA
FT                   AAVLDPKGEAAMAVAMDVADERQVEAGVEAVIKRFGCVDILVSNAGIQIVAPLDEFKFS
FT                   DWKRLLAIHLDGAFLTTRACLKHMYAQGGGSVIYMGSVHSKEASVLKAPYVTAKHGLIG
FT                   LAKVVAKEGAAHGVRANVICPGFVRTPLVEKQIPEQARELGISEEDVIKKVMLKETVDG
FT                   EFTTVEDVARTAVFLAGFPSNALTGQSIVVSHGWFMQ"
     atgatgctgt caggcaaggt cgcggtcatt acaggtgcgg caagcggaat cggcaatgac        60
     atcgcgctcg agttcgtgcg ccacggggcg aaggtcgtga tcgccgatct ccagctcgag       120
     aaggccgaag ctgcggcggc ggtgctcgat cccaaaggtg aggcagcgat ggccgtcgcg       180
     atggatgtcg ccgacgagcg ccaagtggaa gctggcgtcg aggccgtcat aaagcgcttt       240
     ggctgcgttg acattctggt ttcgaacgca ggaatccaga tcgtcgcacc gctggatgag       300
     ttcaaatttt cggactggaa acggctgctc gcgatccatc tcgacggcgc attcctgacg       360
     acgcgggcgt gcctcaagca catgtacgcc cagggcggcg gcagtgtcat ttacatgggc       420
     tccgtccatt ccaaggaagc gtccgtactg aaagcgccct atgtgacggc gaagcatgga       480
     ctcatcgggc tggcgaaggt cgttgcgaag gagggcgcgg cgcacggtgt ccgcgcgaac       540
     gtgatatgcc ccggctttgt ccgcacgccc ctagtcgaaa agcagatccc ggagcaggca       600
     cgggagctgg ggatcagcga ggaagacgtg atcaagaagg tgatgctcaa ggagactgtg       660
     gatggcgagt tcacgaccgt cgaagacgtc gcccgcaccg cggtgttcct cgcggggttc       720
     ccgagcaacg cgctgacggg tcagtccatc gtcgtcagcc acggttggtt catgcaataa       780
//

If you have problems or comments...

PBIL Back to PBIL home page