(data stored in ACNUC7421 zone)

EMBL: AP010803.BIOF

AP010803.BIOF        Location/Qualifiers
FT   CDS_pept        complement(287298..288422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="SJA_C1-02730"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="7-keto-8-aminopelargonate synthetase or related
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95107"
FT                   /db_xref="GOA:D4YXM5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXM5"
FT                   /protein_id="BAI95107.1"
FT                   /translation="MTSEPFRSQLAALEKRGRLRRLMPRAGRDFASNDYLGLASDPIVA
FT                   QAVADAVARGVPVGSGGSRLLRGNAPEHEGLEAKAADFFKTQGALFMANGFAANLALFS
FT                   TLPQRGDLIVADELIHASVHDGIRMSKAAAVFARHNDVQSFADLIAAWRQEGGKGRVWI
FT                   AVETLYSMDGDMAPLGDLATLAARHDAMLILDEAHGTGVFGPSGRGLSAGLDGLHNVVT
FT                   LHTCGKAMGVEGALICGPRLLIDYLINRARAFIFSTAPSPLMAVAVSAALDRIEQASDL
FT                   RARLKTLQVDAAESICAPLGLPAPRSQIIPVILGEDRRAMAAAAALQEAGFDVRGIRPP
FT                   TVPPGTSRLRISLTLNVGRADIAALGEALRRVTA"
     atgaccagcg aacccttccg ctcgcaactg gcggcgctag agaagcgcgg ccgcctgcgc        60
     cgcctgatgc cgcgggccgg gcgggatttc gcctccaacg actatctcgg cctcgcttcc       120
     gaccccatcg tcgcgcaggc ggtggcggac gcggtggcgc ggggcgtgcc ggtgggttcg       180
     ggcggatcgc gcctgctgcg cggcaacgcg ccggagcatg aggggctgga ggcgaaggcc       240
     gccgacttct tcaagaccca gggcgcgctg ttcatggcga acggcttcgc cgccaatctc       300
     gcgctattct ccaccctgcc gcagcggggc gacctgatcg tcgcggacga actgatccac       360
     gccagcgtcc atgacggcat ccgcatgtcg aaggcggcgg cggtcttcgc ccgccataat       420
     gacgtgcaga gcttcgccga cctgatcgcg gcctggcggc aggagggggg caagggccgc       480
     gtctggatcg cggtggagac gctctattcc atggacggcg acatggcccc gctcggcgac       540
     ctggcgacgc tggcggcccg gcacgatgcc atgctgatcc tggacgaagc gcatggcacc       600
     ggcgtcttcg gcccgtccgg gcgcggcctg tcggcgggcc tcgacgggct gcacaatgtc       660
     gtgacgctgc acacctgcgg caaggcgatg ggggtggagg gcgcgctgat ctgcgggccg       720
     cgcctgctga tcgattatct gatcaaccgg gcgcgggcct tcatcttctc caccgcgccc       780
     tcgccgctaa tggcggtcgc ggtgtccgcc gcgctcgacc ggatcgaaca ggcgagcgac       840
     ctgcgcgccc gcttgaagac ccttcaggtc gacgccgccg aatcgatctg cgccccgctg       900
     ggcctgcccg cgccgcgcag ccagatcatc ccggtcatat tgggcgagga tcgccgcgcc       960
     atggccgccg ccgccgccct gcaggaggca gggttcgacg tgcgcggcat ccgcccgccg      1020
     accgtgccgc cgggcaccag ccgcctgcgc atctcgctca ccctgaatgt cggccgcgcc      1080
     gacatcgccg ccctgggcga agcgctgcgc cgggtaacgg catga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page