(data stored in ACNUC7421 zone)

EMBL: AP010803.COAE

AP010803.COAE        Location/Qualifiers
FT   CDS_pept        2411..3004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SJA_C1-00040"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94838"
FT                   /db_xref="GOA:D4YWV6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV6"
FT                   /protein_id="BAI94838.1"
FT                   /translation="MKIYGLTGSIGMGKSAVAAMLRREGVPLFDADAEVHRLQGPGGAL
FT                   LPAIEARFPGTTGPRGVDRAKLGAAVFGHPQELKALEAIVHPAVQQGRRAFLQRNRSRR
FT                   FVVLDIPLLFERHGDRKLAGVIVVTAPAWKQRKRVLARPGMTAAKFRRIVHLQTPDAEK
FT                   RRRADYIIHTGTTFAETRFQVRRLVACLGAKTGR"
     atgaagatct acggtctcac cggctccatc ggcatgggga agtccgccgt cgcggccatg        60
     ttgcggcggg aaggcgtccc gctgttcgat gccgatgcgg aggtgcatcg cctgcagggg       120
     ccgggcggcg cgctgctgcc ggcgatagag gcgcgctttc ccggcacgac gggtccaagg       180
     ggcgtcgacc gggcgaagct gggcgcggcg gtctttggcc atccgcagga attgaaggcg       240
     ctggaggcca tcgtccatcc cgccgtgcag cagggccgca gggcgttcct gcaaaggaac       300
     cgatcgcgca ggttcgtggt gctggacatt ccgctgctgt tcgagaggca tggcgatcgc       360
     aagctggcgg gcgtcatcgt cgtcacggcc ccggcgtgga agcagcgcaa gcgagtcctg       420
     gcccggcccg gcatgaccgc tgcgaaattc cgccggattg tccatctgca aacgcccgat       480
     gctgaaaagc ggcggcgggc ggattatatc atccacacgg ggacgacctt cgcggagacc       540
     cgcttccagg tccgccgcct ggtcgcttgc cttggtgcga agacaggccg ataa             594
//

If you have problems or comments...

PBIL Back to PBIL home page