(data stored in ACNUC7421 zone)

EMBL: AP010803.COBT

AP010803.COBT        Location/Qualifiers
FT   CDS_pept        complement(105870..107696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="SJA_C1-01070"
FT                   /product="cobalamin biosynthesis protein"
FT                   /note="cobalamin biosynthesis protein CobT
FT                   (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole
FT                   phosphoribosyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94941"
FT                   /db_xref="GOA:D4YX59"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX59"
FT                   /protein_id="BAI94941.1"
FT                   /translation="MADRSPLDAFKDVLSGAARSIARDAEVEVGFTADTPHMAGKAIKV
FT                   PTPGRNLPADQVALARGYADANALRLRHHNAKVHNSAAPADATARAVYDAVEQARVEAI
FT                   GSRAMEGVRANLNHALDLKLKSDPIRRARSADEVPLSTALALKVRERLTGQAAPKDVRA
FT                   GLAMVDQWIEDKAGADLDALAMAIDDQRAFQKLTSAMLEHLQLIDADVPPETDDSEPQE
FT                   EGEEEEQSQEDGDSGEDQAGDSDALAEARAEDQGGDTEDGETEYSDEFDADSEEGAEDM
FT                   GEEGMMPVRPNRPMGDLPPGFDYKPYTQLHDEVVTAEDLCDEDELLRLRGFLDQQLVSL
FT                   QGAVTKLANRLQRRLMAQQSRSWDFDQEEGLLDAARLARIVIDPTRSLSYKIERDTEFR
FT                   DTVVTLLIDNSGSMRGRPISIAAISADIMARTLERCGVKTEILGFTTRAWKGGQSREDW
FT                   LAAGRPAMPGRLNDLRHIIYKKADEPWRRARKNLGLMMREGLLKENIDGEALLWAHGRL
FT                   IARNEERRILMVISDGAPVDDSTLSVNSGTYLERHLRQVIEWIENRSPVQLVAIGIGHD
FT                   VTRYYRRAVTIMDAEQLGGTMVEQLAGLFDED"
     atggccgacc gttcgcccct cgacgccttc aaggatgtgc tgtccggcgc ggcgcgctcc        60
     atcgcccgcg acgcggaggt ggaggtgggc ttcaccgccg acacgccgca tatggcgggc       120
     aaggcgatca aggtgccgac gcccggccgc aacctgcccg ccgatcaggt ggcgctggcg       180
     cggggctatg ccgacgccaa tgcgctgcgg ctgcggcacc ataatgcgaa ggtccacaac       240
     agcgccgcgc ccgccgacgc gacggcgcgc gcggtctatg acgcggtcga gcaggcgcgg       300
     gtggaggcga tcggttcgcg ggcgatggag ggggtgcgcg ccaacctcaa ccatgcgctg       360
     gacctgaaat tgaagtccga cccgatccgc cgcgcccgtt ccgccgacga ggtgccgctg       420
     tcgaccgcgc tggcgctcaa ggtgcgggag cggctgaccg ggcaggccgc gccgaaggat       480
     gtgcgggcgg gcctcgctat ggtcgaccag tggatcgagg acaaggcggg cgccgatctg       540
     gacgcgctgg ccatggcgat agacgaccag cgcgccttcc agaagctgac gtccgccatg       600
     ctggagcatc tccagttgat cgacgccgac gtgccgcccg aaaccgacga ttccgaaccg       660
     caggaagagg gcgaggaaga ggagcagagc caagaagacg gcgacagcgg cgaggatcag       720
     gcgggcgaca gcgacgcctt ggcggaggcg cgggccgagg atcagggcgg cgacaccgag       780
     gacggcgaaa ccgaatatag cgacgaattc gacgccgaca gcgaggaagg cgcggaggat       840
     atgggcgagg aaggcatgat gccggtccgc ccgaaccggc cgatgggcga cctgccgccg       900
     ggtttcgact acaagcccta tacgcagctt cacgatgagg tcgtgacggc ggaggatctg       960
     tgcgacgagg atgaactgct gcggctgcgc ggcttcctcg accagcagtt ggtgagcctg      1020
     cagggggcgg tgacgaaact cgccaaccgg ctccagcggc ggctgatggc gcagcagtcg      1080
     cggtcctggg acttcgacca ggaggaaggg ctgctcgacg cggcgcggct ggcgcggatc      1140
     gtgatcgatc cgacgcgctc gctttcctac aagatcgagc gggataccga gttccgcgac      1200
     accgtcgtga cgctgctgat cgacaatagc gggtcgatgc gcgggcggcc catctccatc      1260
     gccgcgatca gcgccgacat catggcgcgc acgctggaac gctgcggcgt gaagaccgag      1320
     atattgggct tcaccacgcg ggcgtggaag ggcgggcaga gccgggagga ctggctggcc      1380
     gccgggcgtc cggccatgcc ggggcgtttg aacgacctgc gccacatcat ctacaagaag      1440
     gccgacgaac cctggcgccg ggcgcgcaag aatctgggcc tgatgatgcg cgaggggctg      1500
     ctcaaggaga atatcgacgg ggaggcgctg ctctgggcgc atggccgcct gatcgcgcgc      1560
     aatgaggaac gccgcatatt gatggtgata tccgacggcg cgccggtgga cgattccacc      1620
     ctgtcggtga acagcggcac ctatctggag cgccatttgc ggcaggtgat cgaatggatc      1680
     gagaatcgct cgcccgtgca gctcgtcgcc atcggcatcg gccatgacgt cacccgctat      1740
     tatcgccgcg ccgtgaccat catggatgcc gaacagcttg gcgggacgat ggtggagcaa      1800
     ctcgccggat tgttcgacga agactag                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page