(data stored in ACNUC7421 zone)

EMBL: AP010803.COMM

AP010803.COMM        Location/Qualifiers
FT   CDS_pept        602916..604424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="SJA_C1-05930"
FT                   /product="magnesium chelatase family protein"
FT                   /note="putative ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95427"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ5"
FT                   /protein_id="BAI95427.1"
FT                   /translation="MVSTVSTVAYLGLEARGVEVQCQLVPGLPNFIVVGLPDKAVAESR
FT                   ERVRNAIAAIGLSLPPKRITVNLSPADLPKEGSHFDLPIALALLGAMGVIDAETLAGYV
FT                   VVGELGLDGRIAPTPGVLLAALHAGERELGLVCPVAQGAEAAWAGQVEVIAAPDLLAIL
FT                   NHFKGAAALSPPRPGEVEPPVRTADLRQVKGQESAKRALEIAAAGGHNLLMVGPPGAGK
FT                   SLMASCLPGILPELTPGEALETSMVASVAGMLEGGRISRARPFRNPHHSASMAALVGGG
FT                   HKARPGEVSMAHLGVLFLDELPEFQRTVLDSLRQPLETGEVTVARANAHVTFPARVQLV
FT                   AAMNPCRCGHLGDPALACSRAPRCAADYQAKVSGPLLDRIDLHVEVQAVTAADLVLPPP
FT                   AEGSAEVAARVAAARAVQTRRYEGTSLRTNAEVDGERLEDVAGPDQAGRELLAQAAAAM
FT                   KLSARGYTRVLRVARTIADLAGAERVGRVHVAEALSYRRRAPVN"
     ttggtttcga cggtatcgac ggtcgcctat ctggggctgg aagcgcgcgg cgtggaggtt        60
     cagtgccagc tcgtgcccgg cctccccaat ttcatcgtcg tcggcctgcc ggacaaggcg       120
     gtcgcggaaa gccgggaacg ggtgcgcaac gccatcgccg ccatcggcct ttcgctgccg       180
     cccaagcgga tcaccgtgaa cctctcgccc gccgacctgc cgaaggaggg gtcgcatttc       240
     gaccttccca ttgcgctggc gctgctgggc gccatgggcg tgatcgatgc cgagacgctg       300
     gcgggctatg tcgtcgtggg ggaactgggg ctggacggcc gcatcgcccc gacgcccggc       360
     gtgctgctcg ccgcgctcca tgcgggggag cgggaactgg gcctggtctg tccggtggcg       420
     cagggcgcgg aagccgcctg ggccggtcag gtggaggtga tcgccgcgcc cgacctgctg       480
     gccatcctca accatttcaa gggcgccgcc gccctctcgc ccccgcgccc tggcgaggtg       540
     gagccgcccg tccggaccgc ggacctcagg caggtcaagg gccaggaaag cgccaagcgc       600
     gcgctggaga tcgcggcggc gggcggccat aatctgctga tggtcggccc gcccggcgcg       660
     ggcaagtcgc tgatggcgag ctgcctgccc ggcatattgc ccgaactgac gccgggcgag       720
     gcgctggaaa cctccatggt ggcgagcgtc gccggcatgc tggagggcgg ccggatcagc       780
     cgcgcccgcc ccttccgcaa tccgcatcac agcgcgtcca tggcggcact ggtcggcggc       840
     gggcacaagg cgcggccggg cgaggtcagc atggcgcatc tgggcgtgct gttcctcgac       900
     gaactgcccg aattccagag gaccgtcctg gactccctgc gccagccgct ggagacgggg       960
     gaagtcaccg tggcgcgggc caatgcgcat gtcaccttcc cggcgcgggt gcagttggtg      1020
     gcggcgatga acccctgccg ctgcggccat ctgggcgatc cggcgctggc ctgttcccgc      1080
     gccccgcgct gcgcggcgga ctatcaggcc aaggtgtcgg gaccgctgct cgaccgcatc      1140
     gacctgcatg tggaggtgca ggcggtgacg gcggcggacc tggtcctgcc ccctcccgcc      1200
     gaaggatcgg ccgaggtcgc ggcccgcgtc gcggcggcgc gggcggtgca gacgcgccgt      1260
     tacgaaggga cttcgctgcg caccaatgcc gaggtggatg gagagcggct ggaggacgtc      1320
     gccgggccgg atcaggccgg ccgcgaattg ctggcgcagg cggccgcggc gatgaagctg      1380
     tcggcgcggg gctatacccg cgtgctgcgc gtggcgcgca ccatcgccga cctggccggc      1440
     gccgagcggg tcgggcgcgt ccatgtggcg gaggcgctca gctaccggcg gcgggccccg      1500
     gtgaactga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page