(data stored in SCRATCH zone)

EMBL: AP010803.COPB

AP010803.COPB        Location/Qualifiers
FT   CDS_pept        496507..497673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="SJA_C1-04910"
FT                   /product="copper resistance protein CopB"
FT                   /note="uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95325"
FT                   /db_xref="GOA:D4YY93"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY93"
FT                   /protein_id="BAI95325.1"
FT                   /translation="MIRILTPLVSAIALFAAAPAFAQDHSMHGMPGMAPPGEVPPAQEK
FT                   KKDKATARPRAQTPAPDATSAMDHSQHQASPAPQGDAAGQPQPASPAMPDMPGMDHSQH
FT                   QDGAMPDMPGMDHSQHGQTATPGTSAMPGMQMTGTALPAGNAPPPPPPSDHFADHDFPG
FT                   AEMARSRDIMMKDSGGNNFGQMLLNLFEYQAHSGRDGYRWDGEGFYGGDINRLWLKSEG
FT                   EGEFGRGIDSAEVQVLYSRAIDPYFNLQGGIRQDFGRGPDRTYATVGVEGLAPGMFEVE
FT                   GALFLSTKGDVLGRVEGYYDQRITQRLILQPRAEVNFAAQDIPENDIGSGLVNIELGAR
FT                   LRYEFSRQFAPYIGVSYLRKAGDTARLSRLAGEDVHATSFVAGVRFWF"
     atgatccgca tcctcacgcc gctggtgagc gcgatcgccc ttttcgctgc cgcgcccgcc        60
     tttgcccagg atcattcaat gcacggcatg cccggcatgg cgccgccggg cgaggtgccg       120
     ccggcgcagg agaagaagaa ggacaaggcc accgccaggc cgcgcgctca gacaccagcg       180
     ccagacgcca cctcggcgat ggaccattcg cagcaccagg ccagtcctgc gccgcaggga       240
     gatgcggccg gtcagccgca acccgcgtct cccgcgatgc cggacatgcc gggcatggac       300
     cactcccagc atcaggacgg cgcgatgccg gacatgcccg ggatggacca ttcgcagcat       360
     ggccagaccg ccacgcccgg aacctccgcc atgcccggca tgcaaatgac cggcacggcg       420
     cttccggccg gcaatgcgcc cccgccgcct ccccccagcg accacttcgc cgatcatgat       480
     tttcccggcg ccgagatggc gcgctcacgc gacatcatga tgaaggacag cggcggcaac       540
     aatttcgggc agatgctgct caacctgttc gagtatcaag cgcatagcgg tcgcgatggc       600
     tatcgctggg atggcgaagg cttttacggc ggcgatatca accggctttg gctcaagagc       660
     gagggcgaag gcgagttcgg ccgcggcatc gatagcgcgg aggtgcaggt gctctacagc       720
     cgggccatcg acccctattt caatcttcag ggcggtatcc gccaggactt cggccgcggg       780
     cccgaccgca cttacgcgac ggtcggcgtc gagggcctgg ctcctggcat gttcgaggtc       840
     gaaggcgcgc tgttcctctc gaccaagggc gatgttctgg gccgggtcga gggctattac       900
     gaccagcgca ttacccagcg cctgatcttg cagccgcgcg ccgaggtcaa tttcgccgcg       960
     caggatattc cggagaacga catcggttcg gggctggtca acatagagct cggcgcgcgc      1020
     ctgcgctatg agttcagccg ccagttcgca ccctatatcg gcgtctccta tctgcgcaaa      1080
     gccggcgaca cggcgcggct gtcgaggctt gccggcgagg acgtccatgc gaccagcttc      1140
     gtcgccggcg ttcgcttctg gttttag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page