(data stored in SCRATCH zone)

EMBL: AP010803.COPC

AP010803.COPC        Location/Qualifiers
FT   CDS_pept        complement(492727..493107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copC"
FT                   /locus_tag="SJA_C1-04860"
FT                   /product="copper resistance protein CopC"
FT                   /note="uncharacterized protein, homolog of Cu resistance
FT                   protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95320"
FT                   /db_xref="GOA:D4YY88"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY88"
FT                   /protein_id="BAI95320.1"
FT                   /translation="MRFFSPLAAIAIVGLSVSAPAYAHPKLVSSAPAANASVSAPSRIT
FT                   LTFSEGLMPRLSGAEIVMTGMPGMPNHRMAVTGFKTSVEGDNKTLVLTLARPLSAGTYQ
FT                   VAWHVVSTDTHRIQGNLAFTVK"
     atgcgtttct tttcgcctct cgcagctatc gccatcgtag gcctgagtgt ttcggctccg        60
     gcctatgccc atcccaagct tgtatcctcg gctccggccg ccaatgccag cgtctcggcg       120
     ccctcgcgca ttacgcttac gttcagcgaa ggtctgatgc ccaggctgtc gggtgccgag       180
     atcgtgatga ccggtatgcc cggcatgccc aaccatcgca tggcggtgac cggcttcaag       240
     acctctgtcg agggcgacaa caagacgctc gtgctgacct tggcgcgccc gctgtcggcc       300
     ggcacctatc aggttgcctg gcacgtcgtg tcgaccgaca cgcatcggat ccagggcaac       360
     cttgccttca cagtgaagta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page