(data stored in ACNUC7421 zone)

EMBL: AP010803.COX11

AP010803.COX11       Location/Qualifiers
FT   CDS_pept        676619..677194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox11"
FT                   /gene_synonym="ctaG"
FT                   /locus_tag="SJA_C1-06730"
FT                   /product="cytochrome c oxidase subunit XI assembly protein"
FT                   /note="cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95507"
FT                   /db_xref="GOA:D4YYS5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS5"
FT                   /protein_id="BAI95507.1"
FT                   /translation="MASLPPSPFDRDRRNRRTMIGMAGVGLAMLGLGFASVPLYRIFCE
FT                   RTGFGGTTQRADADVQVAEAAGHRMSIRFDSNVTPGMPWQFHPERHTQTVTVGARNMAI
FT                   FVAKNLSDRPVTGTATFNVTPSQAGAYFTKIQCFCFTQQTLQPGEQVRMPVIYYVDPKI
FT                   LTDADNKDTQEITLSYTFYPVEQDKKPS"
     atggccagcc ttcctccttc gcccttcgac cgggatcgcc gcaaccggcg gacgatgatc        60
     ggcatggcgg gcgtgggcct tgccatgctg ggcctgggtt tcgcctcggt tccgctctac       120
     cgcatcttct gcgagcggac cggattcggc ggcaccacgc agcgggctga cgccgatgtg       180
     caggttgcag aagcggcggg gcatcgcatg tcgatccgct tcgattccaa cgtgacgccg       240
     ggcatgccgt ggcagttcca cccggaacgc cacacccaga cggtgacggt cggcgcccgg       300
     aacatggcga tcttcgtcgc gaagaacctg tcggaccggc cggtcacggg caccgccacc       360
     ttcaacgtca cgccatccca ggcgggcgcc tatttcacca agatccagtg cttctgtttc       420
     acccagcaaa cgctacagcc gggggagcag gtgcgcatgc cggtgatcta ttatgtcgat       480
     ccgaagatat tgacggatgc cgacaataag gacacgcagg aaatcacgct gagctacacc       540
     ttctatcctg ttgagcagga taaaaagcca agctaa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page