(data stored in ACNUC7421 zone)

EMBL: AP010803.COX15

AP010803.COX15       Location/Qualifiers
FT   CDS_pept        614704..615750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox15"
FT                   /locus_tag="SJA_C1-06020"
FT                   /product="cytochrome c oxidase subunit XV assembly protein"
FT                   /note="uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95436"
FT                   /db_xref="GOA:D4YYK4"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK4"
FT                   /protein_id="BAI95436.1"
FT                   /translation="MTATTLSRPATAVPRPAPIARWLLTVAALVFCMVVVGGITRLTES
FT                   GLSITQWKPIAGAIPPLTHDQWMQAFRDYQKIPEYRQLRQGMTLGDFQFIFFWEWVHRL
FT                   LGRLIGLAFALPLIWFAWKRAIPQGYGLRLVALLALGGLQGAIGWWMVESGLSERTDVS
FT                   HYRLAVHLLTALFIMGGLIWTALDLLTRAKTPFAKPAMLHPFAVVALLALLAQLMFGAF
FT                   TAGLDAGYVSSTWPLMNDHLVPRGIEWLGSLWATVSSDPYLVHFIHRWWAWGVAILLVM
FT                   LARMARQAGQRGPSIAINATVGAQIALGIATVVSGMALPLAVLHQAVGALVVASAAWGA
FT                   HALGERRG"
     atgaccgcga cgaccctgag ccgacccgcc accgccgtcc cacgccccgc gccgatcgcg        60
     cgctggctgc tgacggtcgc agccctcgtc ttctgcatgg tcgtggtcgg cggcatcacc       120
     cgcctgaccg aatccggcct gtcgatcacc cagtggaaac cgatcgccgg cgccatcccg       180
     ccgctgaccc acgaccaatg gatgcaggcc tttcgcgact atcagaagat cccggaatat       240
     cggcagttgc ggcagggcat gacgctgggc gacttccagt tcatcttctt ctgggaatgg       300
     gtgcaccggc tgctggggcg gctgatcggc ctggccttcg cgctgccgtt gatctggttc       360
     gcgtggaaaa gggcgatccc ccagggctat ggcctgcgcc tcgtcgcgtt gctggcgctc       420
     ggcgggctgc aaggcgccat cggctggtgg atggtggaat cgggcctgtc ggagcgcacc       480
     gacgtcagcc attaccggct ggcggtgcat ctgctgacgg cgctgttcat catgggcggg       540
     ctgatctgga ccgcgctcga cctgctgacc cgcgccaaga ctcccttcgc caagcccgcc       600
     atgctccatc ccttcgcggt ggtcgcgctg ctggcgctgc tggcgcaact gatgttcggc       660
     gccttcaccg ccggtctgga cgcgggctat gtctccagca cctggccgct gatgaacgac       720
     catctggtgc cgcgggggat cgaatggctc ggctcgctct gggcgaccgt ctccagcgat       780
     ccctatctgg tccatttcat ccatcgctgg tgggcctggg gcgtcgcgat cctgctggtc       840
     atgctggcgc gcatggcccg gcaggcgggg cagcgcggtc cctccatcgc gatcaacgcg       900
     acggtcggcg cgcagatcgc gctcggcatc gccacggtcg tcagcggcat ggcgctgcct       960
     ctcgcggtgc tgcaccaggc ggtcggcgcg ctggtggtcg catcggccgc ctggggcgcc      1020
     cacgccctgg gcgaacgccg gggatag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page