(data stored in ACNUC7421 zone)

EMBL: AP010803.COX3

AP010803.COX3        Location/Qualifiers
FT   CDS_pept        677231..678061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cox3"
FT                   /locus_tag="SJA_C1-06740"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /note="heme/copper-type cytochrome/quinol oxidase, subunit
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95508"
FT                   /db_xref="GOA:D4YYS6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS6"
FT                   /protein_id="BAI95508.1"
FT                   /translation="MAGAKNHDYHILPPSIWPFFGSMSVLVMAFGAIMWMHPDATPAGG
FT                   GWVFLIGLAGVLFTMYSWWANVITEAHAGDHTPVVQLHLRYGMILFIASEVMFFVGWFW
FT                   SFFDFSLFPSQLAPIEGMFPSKGIEVMNAFELPLLNTLILLCSGTTVTWAHHALIHGDR
FT                   DGLKKGLTLTVILGALFSAIQAYEYAHAPFPFGGSPYSSAFYMATGFHGFHVLVGTIFL
FT                   IVNLIRAHRGDFTPRQHFGFEAAAWYWHFVDVVWLFLFVAIYVWGGWGAPVHGG"
     atggcaggcg ccaagaacca cgattatcat attcttccgc ccagcatctg gccctttttc        60
     ggctccatgt cggtgctggt catggctttc ggcgcgatca tgtggatgca tccggacgcc       120
     acgccggctg gcggcggctg ggttttcctg atcggcctcg cgggcgtgct gttcaccatg       180
     tatagctggt gggccaatgt cattacggag gcgcatgccg gcgaccatac gccggtggtg       240
     cagctccacc tgcgctacgg catgatcctg ttcatcgcat cggaagtcat gttcttcgtg       300
     ggctggttct ggtccttctt cgacttctcg ctcttcccca gccagttggc gccgatcgag       360
     gggatgttcc cctcgaaggg catagaggtg atgaacgcct ttgaactgcc gttgctcaac       420
     acgctgatcc tgctctgctc cggcacgacc gtgacctggg cgcaccacgc cctgatccat       480
     ggcgaccggg acgggctgaa gaaggggttg acgctgacgg tcatcctggg cgcgctcttc       540
     tccgcgatcc aggcctatga atatgcccat gcgcctttcc ccttcggcgg cagcccctac       600
     agctcggcct tctacatggc gaccggcttc cacggcttcc acgtgctggt gggcacgatc       660
     ttcctgatcg tgaacctgat ccgcgcgcat cggggcgatt tcaccccgcg ccagcatttc       720
     ggcttcgaag ccgccgcctg gtactggcat ttcgtcgacg tggtgtggct gttcctcttc       780
     gtcgccatct atgtctgggg cggctggggc gcgccggtcc acggcggctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page