(data stored in ACNUC7421 zone)

EMBL: AP010803.COXA

AP010803.COXA        Location/Qualifiers
FT   CDS_pept        673786..675453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="SJA_C1-06700"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="heme/copper-type cytochrome/quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95504"
FT                   /db_xref="GOA:D4YYS2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS2"
FT                   /protein_id="BAI95504.1"
FT                   /translation="MTTITADHHGDHAHDHHDADHKPAFFQRWFMSTNHKDIGTLYLIF
FT                   AIVAGIIGGAISGLMRAELAQPGIQYLQTWAQFSDGPEATLDQAYHLWNVLITAHGLIM
FT                   VFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLIPAFVLLLGSTFVPGGTGN
FT                   GAGTGWTVYAPLSTSGSAGPAVDMAILSLHVAGVSSILGAINFITTILNMRAPGMTLHK
FT                   MPLFVWSVLVTAFLLLLALPVLAAAITMLLTDRNFGTTFYDAAGGGDPELYQHLFWFFG
FT                   HPEVYIMILPGFGIISQIVSTFSRKPVFGYLGMAYAMVAIGVVGFVVWAHHMFTTGMSV
FT                   NVKMYFTAATMVIAVPTGIKIFSWIATIWGGSISYKTPMVWALGFIFLFTVGGVTGVVL
FT                   ANGGVDDVLHDTYYVVAHFHYVLSLGAVFGLFAGFYYWFPKMSGRMYNEFLGHLHFWVF
FT                   FVGVNMLFFPMHFLGLSGMPRRYPDYPEAFAYWNKFASHGYEIMAAGMLIFFVNLIWSL
FT                   AAGKKAEGNPWGEGATTLEWTLSSPPPFHQFETLPVID"
     atgaccacca ttaccgcaga tcatcacggc gatcatgctc atgatcatca tgacgccgac        60
     cacaagccgg ccttcttcca gcgttggttc atgtcgacca accacaagga catcggcacg       120
     ctctacctga tcttcgcgat cgtcgccggc atcatcggcg gcgcgatttc gggcctgatg       180
     cgcgccgaac tggcgcagcc gggcatccag tatctccaga cctgggcgca gttcagcgac       240
     ggtcccgaag cgacgctgga ccaggcctat cacctctgga acgtgctgat caccgcccac       300
     ggcctcatca tggtcttctt catggtgatg cccgcgatga tcggcggctt cggcaactgg       360
     ttcgtgccga tcatgatcgg cgcgccggac atggccttcc cgcggatgaa caatatcagc       420
     ttctggctgc tcatccccgc cttcgtcctg ctgctcggct cgaccttcgt gcccggcggc       480
     accggcaacg gcgctggcac cggctggacg gtctatgccc cgctctcgac cagcggttcg       540
     gcgggtccgg cggtggacat ggcgatcctg tcgctccacg tcgcgggcgt cagctcgatc       600
     ctgggcgcga tcaacttcat caccaccatc ctcaacatgc gcgcaccggg catgaccctg       660
     cacaagatgc cgctgttcgt ctggtcggtg ctggtcaccg ccttcctgct gctgctcgcg       720
     cttcccgtgc tcgccgcggc gatcaccatg ctgctgaccg accgcaattt cggcaccacc       780
     ttctatgatg cggccggcgg cggcgatccc gaactctacc agcatctctt ctggttcttc       840
     ggccatcccg aagtgtacat catgatcctg ccgggcttcg gcatcatcag ccagatcgtc       900
     tcgaccttca gccgcaagcc ggtgttcggc tatctcggca tggcctacgc catggtcgcg       960
     atcggcgtgg tcggcttcgt cgtctgggcg caccacatgt tcaccaccgg catgtcggtg      1020
     aacgtgaaga tgtacttcac cgccgccacc atggtgatcg cggtgccgac cggcatcaag      1080
     atcttctcct ggatcgcgac gatctggggc ggctcgatca gctacaagac cccgatggtc      1140
     tgggcgctgg gcttcatctt cctgttcacc gtgggcggcg tcaccggcgt ggtgctggcg      1200
     aatggcggcg tcgacgacgt gctgcacgac acttattatg tcgtcgcgca cttccactat      1260
     gtgctctcgc tgggcgcggt gttcggcctg ttcgcgggct tctactactg gttcccgaag      1320
     atgtcgggcc ggatgtacaa cgaattcctc ggccatctgc acttctgggt gttcttcgtc      1380
     ggcgtgaaca tgctgttctt cccgatgcac ttcctgggcc tgtcgggcat gccgcgccgc      1440
     tatcccgact atccggaggc gttcgcctat tggaacaagt ttgccagcca cggctatgag      1500
     atcatggccg ccggcatgct gatcttcttc gtcaacctca tctggtcgct ggccgcgggc      1560
     aagaaggcgg agggcaatcc ctggggcgaa ggcgccacca cgctggaatg gaccctgtcc      1620
     agcccgccgc ccttccacca gttcgaaacg ctgccggtca tcgactga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page