(data stored in ACNUC7421 zone)

EMBL: AP010803.COXB

AP010803.COXB        Location/Qualifiers
FT   CDS_pept        672754..673767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /locus_tag="SJA_C1-06690"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="heme/copper-type cytochrome/quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95503"
FT                   /db_xref="GOA:D4YYS1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS1"
FT                   /protein_id="BAI95503.1"
FT                   /translation="MNKVKSLVLAGLLAFAPTLAMNGPALAQDNAAVAAPAAGNEAVAA
FT                   DSAGNAAAPAAEAAPAAKVAAPPRMKPTPGIGMPMPGEITLQKQFSPTGHTARWLHDVM
FT                   LLPIITIISIFVLILMLYVMVRFRRSANPTPSKTSHNTVIEVIWTVVPVVILLAIAVPS
FT                   IGLLADQYKPAPKDALTVKVTGYQWYWGYEYPDNGIPEFVSNMLPKDKAEANGEPYLLA
FT                   PDNRLVLPVGRPIKLIITGADVIHSFAVPSLWVKMDAVPGRLNEKSFTIEKPGVYYGQC
FT                   SELCGARHGFMPIAIEALEPAQFDQWLLSQGGTLKGAAAATTAEAAAPAAAPAAKL"
     atgaacaagg tgaaatcgct cgttctcgcc gggttgttgg cctttgcgcc gacgctcgcc        60
     atgaacggtc cggcgctggc ccaggacaat gccgcggttg cggctccggc tgccgggaat       120
     gaagctgtgg ccgctgattc ggccggcaat gcagcggctc ccgccgcgga agccgcgccc       180
     gccgcgaagg tggccgcgcc gccccggatg aagccgacgc cgggcatcgg catgcccatg       240
     ccgggtgaaa tcactctcca gaagcagttt tcgcccaccg ggcacaccgc acgctggctg       300
     catgacgtga tgctgctgcc gatcatcacc atcatctcga tcttcgtgct gatcctgatg       360
     ctctacgtga tggtccgttt ccgccgcagc gccaatccga cgccgtccaa gacctcgcac       420
     aacacggtga tagaggtgat ctggaccgtg gtgccggtgg tgatcctgct ggccatcgcg       480
     gttccctcca tcggcctgct cgccgaccag tacaagcccg cgcctaagga tgcgctgacc       540
     gtcaaggtta ccggctatca gtggtattgg ggctatgaat atcccgacaa cggcatcccg       600
     gaattcgttt ccaacatgct gcccaaggac aaggcggagg cgaacggcga gccctatctg       660
     ctcgctcccg acaatcgcct ggtcctgccg gtcggccgcc cgatcaagct gatcatcacc       720
     ggcgccgacg tcatccacag cttcgcggtc ccctccctct gggtgaagat ggacgcggtg       780
     ccgggccgcc tcaatgaaaa gagcttcacc atcgagaagc cgggcgtcta ttacggccag       840
     tgttcggaat tgtgcggcgc gcgccacggc ttcatgccga tcgcgatcga ggctctggaa       900
     cccgcgcagt tcgaccagtg gctgctgtcg cagggcggca cgctgaaggg tgccgccgcc       960
     gcgaccacgg ctgaagctgc cgcgcccgcc gccgctcctg ccgccaagct ttga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page