(data stored in ACNUC7421 zone)

EMBL: AP010803.CUSA

AP010803.CUSA        Location/Qualifiers
FT   CDS_pept        527243..530386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /gene_synonym="czcA"
FT                   /locus_tag="SJA_C1-05250"
FT                   /product="copper/silver efflux system membrane protein
FT                   CusA/CzcA"
FT                   /note="copper efflux system membrane protein CusA /
FT                   putative silver efflux pump, CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95359"
FT                   /db_xref="GOA:D4YYC7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC7"
FT                   /protein_id="BAI95359.1"
FT                   /translation="MIAHLIRWSVRNRFFVVLGMLALVGAGLWAVRSTPIDALPDLSDV
FT                   QVVIRTSYPGQAPQIVENQITYPLTTTMLSVPGAKTVRGYSFFGDSFVYVIFEDGTDLY
FT                   WARSRVLEYLNQVQGRLPASARSALGPDATGVGWVYEYALVDRTGRHDLSQLRGLQDWF
FT                   LRYELKTVTGVAEVASIGGMVKQYQVLLDPVKLAAYGVTHAQAVQAISQANQEAGGSVL
FT                   EMAEAEYMVRASGYLKTLDDFRAIPLKTAAGGVPVRLGDVATIQVGPEMRRGIAELNGE
FT                   GEVAGGVVILRSGKNARETIAAVKDKLADLRKSLPPGVEVVTVYDRSQLIDRAVENLTR
FT                   KLVEEFIVVALVCALFLWHVRSALVAILTLPLGVLAAFVVMRFQGVNANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKRIERWEQDHPDRHLDGEMRWIVVTEAAAEVGPALFFSLLIIT
FT                   LSFIPVFTLEAQEGRLFAPLAFTKTYAMGAAAILSVTLVPILMGWLIRGRIPAEQANPV
FT                   NRWLTNIYRPAIDWTMKRPKAVLLIAALVFATTAWPLSRLGGEFMPNLDEGDLLYMPSA
FT                   LPGLSAAKASELLQQTDRLIKTVPEVESVFGKAGRAETATDPAPLEMFETTIQFKPRDQ
FT                   WRSGMTPERLVDELDRRVKLPGLANIWVPPIRNRIDMLATGIKSPIGVKVSGSDLAELD
FT                   RIAHDVETVARSVPGVSSALAERLTGGRYVDVDIDRAAAARFGLNIADVQAIVSGAIGG
FT                   ETIGETVEGLARYPISVRYPRELRDSLERLRALPILTPAGQQITLGTVANVSIAEGPPM
FT                   LKTENARPSTWVYVDVRGRDLASVVGDLQRAVAKQVRLSPGVSIAYSGQFEYLERAVDR
FT                   LKLVVPATLLIIFVLLYLIFGRFDEAALIMGTLPFALTGGIWTLYLLGFNQSIATGVGF
FT                   IALAGVSAEFGVVMLIYLKNALAERGAHPDAAEVEAAVREGALLRVRPKAMTVAVILAG
FT                   LLPILLGSGAGSEVMSRIAAPMIGGMLTAPLLSMFVLPAAYLLLRRPKTDPIPQPVSS"
     gtgatcgccc atctcatccg ctggtcggtg aggaaccgct tcttcgtcgt gctcggcatg        60
     ctcgcgctgg tcggcgcggg cctgtgggcg gtgcgctcga ccccgatcga cgcgctgccc       120
     gatctttccg acgtgcaggt cgtgatccgc acttcctatc cgggtcaggc gccgcagatc       180
     gtcgagaacc agatcaccta tccgctcacc accaccatgc tgtcggtgcc cggcgccaag       240
     acggtgcgcg gctatagctt cttcggcgac agcttcgtct atgtgatctt cgaggacggc       300
     accgatctct actgggcgcg cagccgcgtg ctcgaatatc tcaaccaggt ccagggtcgg       360
     ttgccggcca gcgcccgcag cgcgctcggg ccggacgcga ccggggtcgg ctgggtctat       420
     gaatatgcgc tggtcgaccg caccggccgg cacgatctct cgcagcttcg cgggttgcag       480
     gactggttcc tgcgctacga gctgaagacc gtgaccggcg tggccgaagt cgccagcatc       540
     ggcggcatgg tcaagcagta ccaggtgctg ctcgatccgg tgaagctcgc ggcctacggc       600
     gtaacccacg cccaggcagt gcaggcgatc agccaagcca atcaggaagc cggcggctcg       660
     gtgctggaaa tggccgaggc cgaatatatg gtccgcgcct cgggctatct gaaaacgctc       720
     gacgatttcc gggcaatccc gctcaagact gcggcgggcg gcgtgcccgt ccggctcggc       780
     gatgtcgcca cgatccaggt cggccccgag atgcggcgcg gcatcgccga actgaacggc       840
     gaaggcgagg tcgccggcgg cgtcgttatt cttcggtcag gcaagaacgc ccgtgagacc       900
     atcgcggcgg tcaaggacaa gctcgccgat ctcaggaaaa gcctgccgcc gggcgtcgag       960
     gtggtcacgg tctatgaccg ctcgcagctg atcgatcgcg cggtcgagaa cctcacccgc      1020
     aagctggtcg aggagttcat cgtcgtcgca ttggtctgcg ccctgttcct ctggcacgtc      1080
     cgctcggcgc tggtcgcgat cctgaccttg ccgctcggtg tgctggccgc gttcgtcgta      1140
     atgcggttcc agggggtgaa cgccaacatc atgtcgctgg gcggcatcgc catcgccatc      1200
     ggcgcgatgg tggatgcggc ggtcgtcatg atcgagaacg cccacaagag gatcgaacgc      1260
     tgggagcagg atcacccgga cagacatctc gatggcgaga tgcgctggat cgtcgtcacc      1320
     gaggcggcgg ccgaggtcgg gccggcgctg ttcttcagcc tgctgatcat cacgctgtcg      1380
     ttcattccgg tcttcaccct ggaggcgcag gaaggccggc tgttcgcgcc gctcgccttc      1440
     accaagacct atgcgatggg cgcggccgcg atcctgtcgg tgaccctggt gccgatcctg      1500
     atgggctggc tgatccgggg ccgcattccg gccgagcagg ccaatccggt caatcgctgg      1560
     ctcaccaata tctaccggcc cgcgatcgac tggacgatga agcggcccaa ggcagtgctg      1620
     ctgatcgcgg ctctggtgtt cgccaccacg gcctggccgc tcagccggct cggcggcgag      1680
     ttcatgccca atctcgacga gggcgacctg ctctacatgc cctcggcgct gccgggcctc      1740
     tcggccgcca aggcgagtga gctgctccag cagaccgacc gcctgatcaa gaccgtgccc      1800
     gaagtcgaaa gcgtgttcgg caaggccggc cgcgccgaga ccgcgaccga tcccgcgccg      1860
     ctcgaaatgt tcgagacgac gatccaattc aagccccgcg accagtggcg gtcgggcatg      1920
     acgcccgaac gccttgtcga cgagctcgat cgccgggtga agcttccggg tctcgccaat      1980
     atctgggtgc cgccgatccg caaccgcatc gacatgctcg cgacgggcat caagagcccg      2040
     atcggggtca aggtgtcggg cagtgacctc gccgagctcg accgcatcgc gcatgatgtc      2100
     gagaccgtgg ccaggagcgt gcccggcgtc agctcggcgc tcgccgagcg gctgaccggc      2160
     ggacgctatg tcgatgtcga catagaccgc gccgccgccg cgcggttcgg gctcaacatc      2220
     gccgacgtcc aggccatcgt ctccggcgcg atcggcggcg agacgatcgg cgagacggtc      2280
     gagggcctcg cccgctatcc gatcagcgtg cgctatccgc gcgaattgcg cgacagcctc      2340
     gaaaggctgc gggcgctacc gatcctgacg cccgcgggcc agcagatcac cttgggcacc      2400
     gtggcaaacg tctcgatcgc cgagggaccg ccgatgctca agaccgagaa tgcccggcct      2460
     tcgacctggg tctacgtcga tgtgcgcggg cgcgatcttg cctcggtggt cggcgatctg      2520
     cagcgtgcgg tggcgaaaca ggtcaggctc tcgcctgggg tcagcatcgc ttactctggc      2580
     cagttcgaat atctcgagcg cgcggtcgac cgcttgaagc tggtcgtgcc cgcgacgctg      2640
     ctgatcatct tcgtgctgct ctacctcatc ttcggccgct tcgacgaggc ggcgctgatc      2700
     atggggacgc tgccgtttgc gctgaccggc ggcatctgga cgctttatct gctggggttc      2760
     aaccagtcga tcgccaccgg ggtcgggttc atcgcgctcg ccggcgtctc cgccgagttc      2820
     ggggtggtga tgctgatcta tctcaagaac gcgctggccg agcgcggcgc acatccggac      2880
     gctgccgagg tcgaggccgc cgtgcgcgaa ggcgcgctgc tgcgcgtccg tcccaaggcg      2940
     atgacggtgg cggtgatcct ggccggcctg ctgccgatcc tgctgggatc aggcgcgggt      3000
     tcggaggtca tgagccggat tgccgcgccg atgatcggcg gcatgctgac cgcgcccttg      3060
     ctctcaatgt tcgtcctgcc cgccgcctac ctgctgttgc gccggcccaa gaccgatccc      3120
     atccctcaac ccgtttcatc atga                                             3144
//

If you have problems or comments...

PBIL Back to PBIL home page