(data stored in ACNUC7421 zone)

EMBL: AP010803.CUSB

AP010803.CUSB        Location/Qualifiers
FT   CDS_pept        525756..527246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="SJA_C1-05240"
FT                   /product="copper efflux system membrane protein CusB"
FT                   /note="type I secrection membrane fusion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95358"
FT                   /db_xref="GOA:D4YYC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC6"
FT                   /protein_id="BAI95358.1"
FT                   /translation="MTLDKSALRWGASILAVALLAGGTGYWAGHRQAPQSEATTPAGAG
FT                   KVLYWYDPMFPNQKFDKPGKSPFMDMQLVPRYADGGSAGAAPTVAVDPAARQSLGLRVV
FT                   AAKMGSLASALEVTGTIDFNQRDVAVIQARSGGFVSRVYARAPGDVVRAGAPIADLLLP
FT                   EWGGAQTEYLSVRRLGKPDLTAAARQRLRLMGMSDGLIASVERSGRPNGVVTITTPISG
FT                   TIQTLDARAGVTLAMGQTLAQVSGLGTVWLNAAVPEARAGDVRVGQNASTTLAGFPGER
FT                   FAGRVIAILPTTQADSRTLTVRIELPNRDGRLRPGMFASVALGGDAKPALLVPSEAVIR
FT                   TGRRTLVMLAAGDGRYHPAEVRIGREAGGETEILAGLSPGENVVVSGQFLIDSEASLSG
FT                   IEARPIGGGAASATIAAPASKATLYETTGKIERITANSVTLSHEPVPALDWPAMTMTFA
FT                   LANPGIARGFKAGDRVRFGFDRPPAGPTLRHMAKVAGQ"
     atgacgctcg ataaatccgc gctgcgctgg ggcgcatcga tcctggctgt cgcgctgctg        60
     gccggcggca caggctattg ggctggccat cgccaggcac cgcaatcgga ggcgaccacg       120
     cccgccgggg caggcaaagt cctttactgg tacgatccga tgttccccaa ccagaagttc       180
     gacaagcccg gcaagtcgcc cttcatggat atgcagctcg tgccgcgata cgcggacgga       240
     ggaagcgccg gcgcggcccc cacggtcgcc gtcgatcccg ccgcgcggca gagcctggga       300
     ttgcgggtcg tcgcggcgaa gatgggcagc cttgcctcgg ccctcgaggt caccggcacg       360
     atcgacttca accagcgcga cgtcgccgtc atccaggcgc gttcgggcgg gttcgtgagc       420
     cgcgtctatg cgcgagcgcc cggggacgtg gtccgcgccg gcgcgccgat cgcggacctg       480
     ctcctgcccg aatggggcgg cgcgcagacc gaatatctga gcgtcaggcg gctcggcaag       540
     cccgacctca ccgcggccgc gcgccagcga ctgcggctga tgggcatgtc cgacggcctc       600
     atcgccagcg tcgagcggag cggacgcccg aacggcgtgg tgacgatcac gacgccgatc       660
     tcgggcacga tccagacgct cgacgcccgt gccggcgtga cgctcgccat gggccagacg       720
     ctcgcccagg taagcgggct cggcaccgtc tggctcaatg ccgcggtgcc cgaagcgcgc       780
     gcgggcgatg tccgggtcgg ccagaatgcc agcaccacgc tggcgggctt ccccggcgag       840
     cgcttcgccg gccgggtgat cgcgatcctg ccgaccacgc aggccgacag ccgcacgctc       900
     accgtgcgga tcgagctgcc caaccgggac ggccggttgc ggccgggcat gttcgccagc       960
     gtcgcgcttg gcggcgatgc caagccggcg ctgctggtgc cgagcgaagc ggtgatccgc      1020
     acgggcaggc gcacgctcgt catgctggcc gcaggcgacg ggcgctatca tcccgccgag      1080
     gtccgcatcg gccgcgaggc aggcggcgag accgagatcc ttgccggcct gtcgcccggc      1140
     gagaacgtcg tcgtctcggg gcagttcctg atcgattccg aggcgagcct gtcgggaatc      1200
     gaggcgcggc cgatcggcgg cggtgcggca tcggcgacca tcgccgcgcc ggcgtcgaaa      1260
     gccacgctgt acgagacgac gggcaagatc gagcggatca cggccaattc ggtgacgctc      1320
     agccacgagc ccgttcccgc gctcgactgg ccggcgatga cgatgacctt cgcgctcgcc      1380
     aatccgggca tcgcgcgcgg cttcaaggcg ggtgaccggg tccggttcgg gttcgaccgg      1440
     cccccggcgg gaccgacgct gcggcatatg gcgaaggtgg cgggccagtg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page