(data stored in ACNUC7421 zone)

EMBL: AP010803.CUSF

AP010803.CUSF        Location/Qualifiers
FT   CDS_pept        530383..530787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="SJA_C1-05260"
FT                   /product="copper efflux system periplasmic protein CusF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95360"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC8"
FT                   /protein_id="BAI95360.1"
FT                   /translation="MKEKTMNHARLTIALGLAALTAACGKKAEAPVATETNEAAPAATM
FT                   SGDMGNMSMAPDANAAIKAKGHGTVTAIDKAAGTITLDHGPIPEAKWPAMTMAFKAAPS
FT                   ITDAVKVGDKVDFDLSLKGSDGEVTAIAKQ"
     atgaaggaga agacgatgaa ccatgcacga ctgaccattg ccctcggcct cgccgccctg        60
     actgccgcgt gcggcaagaa ggcggaggcc cccgttgcga ctgagaccaa cgaggcggcg       120
     cccgccgcga ccatgagcgg cgacatgggc aacatgtcga tggcgcctga cgcgaacgcc       180
     gcgatcaagg ccaagggcca tggcaccgtc accgcgatcg acaaggcggc gggcaccatc       240
     acgctcgatc atggtccgat cccggaggcc aagtggcccg cgatgacgat ggcgttcaag       300
     gccgcgccgt cgatcaccga tgcggtcaag gtcggcgaca aggtcgattt cgacctctcg       360
     ctcaagggca gcgatggcga ggtcaccgcg atcgcaaagc agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page