(data stored in ACNUC7421 zone)

EMBL: AP010803.CYSQ

AP010803.CYSQ        Location/Qualifiers
FT   CDS_pept        complement(83224..84021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="SJA_C1-00830"
FT                   /product="inositol monophosphatase family protein"
FT                   /EC_number="3.1.3.25"
FT                   /note="archaeal fructose-1,6-bisphosphatase or related
FT                   enzyme of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94917"
FT                   /db_xref="GOA:D4YX35"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX35"
FT                   /protein_id="BAI94917.1"
FT                   /translation="MPAADISLRDVVTAASDAADRALTLWAGGQTRVRQWEKVPGHPVC
FT                   EADLELDAMLRERLYAIDPSAGWLSEETADTVHRLDLPRVWVVDPIDGTRDYLRGRPGW
FT                   AVSVALVEHGEARFGILAAPARNELWIAQAGAGATRNGRTLRAGSRSILRGSRVPADQL
FT                   PRHDRDLVTVDKPNSIALRMAMVAADEADLVATVRWGNEWDVAAAALIAQEAGAIVTDA
FT                   LSNPFSFNRPQPTAFGLLCAAPGIHAAAAERLAPRARKILGRG"
     ttgccggcgg ctgacatctc cctgcgcgat gtcgtgacgg ccgcgtcgga cgccgcggac        60
     cgggccttga cgctctgggc tggcggccag acccgtgtgc gccagtggga aaaggtgccc       120
     ggccatccgg tgtgcgaggc cgatctggaa ctggacgcga tgctgcgcga gcggctctac       180
     gccatcgatc cttccgccgg atggctgtcg gaggagacgg ccgacaccgt gcaccggctg       240
     gacctgcccc gcgtctgggt ggtcgatccc atcgacggca cgcgggacta tctgcgcggg       300
     cggccaggct gggcggtttc ggtggcgctg gtggagcatg gcgaggcccg cttcggcata       360
     ttggcggcgc ccgcccggaa cgagctgtgg atcgcgcagg cgggcgcggg ggcgacccgc       420
     aacgggcgga ccttgcgggc cggatcgcgt tccatcctgc gcggttcgcg ggtgcccgcc       480
     gaccagcttc cccgccatga ccgcgatctc gtcaccgtgg acaagcccaa cagcatcgcg       540
     ctgcgcatgg cgatggtcgc ggcggacgag gccgatctgg tcgccacggt gcgctggggc       600
     aatgaatggg atgtcgccgc cgccgcgctg atcgcgcagg aggccggcgc catcgtcacc       660
     gatgcgctca gcaacccctt ttccttcaac cggccgcagc cgaccgcctt cggcttgctg       720
     tgcgcggcgc cggggattca cgcggcggcc gcggaacgcc tggcgccgcg ggcgcggaag       780
     atattggggc gggggtaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page