(data stored in SCRATCH zone)

EMBL: AP010803.CZCB

AP010803.CZCB        Location/Qualifiers
FT   CDS_pept        complement(545924..547105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="SJA_C1-05390"
FT                   /product="metal ion efflux membrane fusion protein family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95373"
FT                   /db_xref="GOA:D4YYE1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE1"
FT                   /protein_id="BAI95373.1"
FT                   /translation="MMKSFYLAGAASLALLLAACGGKDGGNEATAEGAAANETAAGTEK
FT                   GGAEGGHAGEGVVTLGADQIATAGVQVGRPIIGGAGTIELPAIIEGDPQGTQVVSAAIA
FT                   GRVVALTRNLGQSVGRGQTIAVIESREAAQIKGEVEAARARLQLANSNLAREQRLFAQR
FT                   VSPEQDLIAARTAATEARIALTQAQSMVSAAGVGGGGLNRLGIAAPISGQIIARPVTLG
FT                   QTVAADAELYRIANLSQVSIALNLKPEDAGRVRPGNTVLVKAAGRQATARVTFVSPALD
FT                   PQTRLVPALATLDNRGGEWRVGEPVTAAVQLTGSGGSGAVRVPTTAVQSFEGKSVVFVR
FT                   TPTGFKATPVQLGDASGDTVIVRSGLTGNEQIATTGSFTLKAEIGKGEASHED"
     gtgatgaaga gcttttatct cgcgggcgcg gcgtcgctcg ccctgctctt ggctgcctgc        60
     ggcggcaagg atggcggaaa cgaggcaact gccgaaggcg cagctgccaa tgagacggca       120
     gcgggcacgg aaaagggcgg tgctgaaggc ggtcatgccg gtgaaggcgt cgtcacattg       180
     ggtgccgacc agatcgccac agcgggcgtc caggtcggac ggccgatcat cggcggggcc       240
     gggacgatcg agctgcccgc gatcatcgag ggcgacccac agggaacgca ggtcgtctcg       300
     gccgcaattg cgggacgcgt ggtcgcgctc acccgtaacc tcggccaatc ggtcggacgc       360
     ggccagacca ttgcggtcat cgaaagccgc gaggcggcgc agatcaaggg cgaggtcgag       420
     gcggcgcggg cgcggcttca gctcgctaat tcgaacctcg cgcgcgaaca gcggctgttc       480
     gcgcagagag tctcccctga acaggatctg atcgccgccc gcacagcggc gacggaggcg       540
     cggatcgccc tgacgcaggc gcagagcatg gtttcggcgg cgggtgtcgg cggcggcggg       600
     ctcaaccggc tcggcattgc cgcgccgatc tcgggccaga tcattgcgcg ccccgtgacg       660
     ctgggacaaa cggtcgcggc ggatgccgaa ctctatcgca tcgccaacct gagccaggtg       720
     tcgatcgcgc ttaatctcaa gcccgaggat gcgggccggg tgcgtcccgg caatacggtg       780
     ctggtgaagg cggcaggccg tcaggcgacc gcccgcgtga ccttcgtgtc gccggcgctt       840
     gatccgcaga cgcggctcgt gcctgcgctc gccaccctcg acaatcgcgg tggcgaatgg       900
     cgggtcggcg agcctgtgac ggcagccgtg cagctcacgg gcagcggcgg gagcggggcg       960
     gtccgcgtgc cgacgacggc ggtccagagt ttcgagggca agtcggtcgt gttcgtgcgc      1020
     acgcccaccg gcttcaaggc gaccccggtc cagctcggcg atgcgtcggg cgacacggtg      1080
     atcgtccggt cgggcctgac cggcaacgaa cagatcgcca ccaccggaag tttcacgctc      1140
     aaggccgaga tcggcaaggg cgaagcgagc cacgaggatt aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page