(data stored in ACNUC7421 zone)

EMBL: AP010803.CZCC

AP010803.CZCC        Location/Qualifiers
FT   CDS_pept        524497..525759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="SJA_C1-05230"
FT                   /product="cation resistance protein CzcC"
FT                   /note="heavy metal RND efflux outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95357"
FT                   /db_xref="GOA:D4YYC5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC5"
FT                   /protein_id="BAI95357.1"
FT                   /translation="MIMMPRRAVRRLLLSIGATLASAWAVPVSAGPLTYEQAVRLAAAN
FT                   APSLKARAAATAGARSSAVAADRLPDPTLDLGLQNFPVSGPNAGSFTRDDFTMATIGFS
FT                   QTFPNLAKRHARAARAAADIGIAEAGELVEGRNVRLETALAWVDLYYGERRLRQLDLLD
FT                   ASLDDLQKTVTARLASGSARPSQALEPDQLRAAIADRRAEMAAVVAQARARLARYTGDP
FT                   DPQATGDPPMLDVDPIRLRAGIDALPALRAQDARIAVAEADVRLARADKRPDWKVGVTY
FT                   GRRDPMYGDMASVGVSIDLPLFAGKRQNPRIAASESLAQGGRFDREAIRRELVAQLDAD
FT                   LADHAMHLSRLRNARETLVPLARHRAELDRDSYGAGKLDLGAALLTTLGLAEAEVEALN
FT                   READVARDAVRITITYGEERP"
     atgatcatga tgccgaggcg cgctgtgcga cgcctgttgc tctctatcgg tgcgacgctt        60
     gcgagcgcct gggccgtgcc ggtgtcggcc ggcccgctca cctacgagca ggcagtgagg       120
     ctcgctgccg ccaacgcgcc aagcctcaag gcgcgcgcgg cggcgacagc cggcgcccgc       180
     tcttcggcgg tcgcggccga tcgcctgccc gatccgacgc tcgacctggg cctgcagaac       240
     ttcccggtga gcggccccaa tgccggcagc ttcacgcgcg acgatttcac tatggcgacg       300
     atcgggttca gccagacctt ccccaatctc gccaagcgcc atgcacgcgc cgcgcgcgcc       360
     gcggccgata tcggtatcgc cgaggcgggc gagctggtcg aaggccgcaa cgtgcggctc       420
     gagaccgccc tcgcctgggt cgatctctat tatggagaac gccggctccg gcagctcgac       480
     ctgctcgatg ccagcctcga cgacctgcag aagaccgtga ccgcacgcct ggcgtcgggc       540
     agcgcgcgcc cgagccaggc gctcgagccc gaccagctcc gcgccgccat cgccgatcgc       600
     cgcgccgaga tggctgcggt ggtggcgcag gcgcgggccc ggctcgcgcg ctataccggc       660
     gaccccgacc cgcaggcgac gggcgacccg ccgatgctcg atgtcgatcc gatccggctg       720
     cgggccggga tcgatgcgct tcccgccctg cgcgcgcagg acgcgcggat cgcagtcgcc       780
     gaagcggacg tgcgtctcgc gcgcgccgac aagcgccccg actggaaggt cggcgtcacc       840
     tatggccggc gcgatcccat gtacggcgac atggcctcgg tcggcgtgtc gatcgacctg       900
     ccgctgttcg ccggcaagcg ccagaacccc aggatcgctg caagcgagag ccttgcgcaa       960
     gggggtcggt tcgaccgcga ggcgatccgc cgcgagctgg tggcgcagct cgacgccgat      1020
     ctcgcagacc atgccatgca tctctcccgg ttgcgcaatg cccgcgagac gctggtgcca      1080
     ctcgccaggc accgcgccga gctcgaccgc gacagctatg gcgccggcaa gctcgacctt      1140
     ggcgccgcgc tgctcacgac gctcgggctc gcggaggccg aggtcgaggc gctcaaccgc      1200
     gaagccgacg tcgcgcgcga cgcggtccgc atcactatca cctatgggga ggagcggcca      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page