(data stored in ACNUC7421 zone)

EMBL: AP010803.DAT

AP010803.DAT         Location/Qualifiers
FT   CDS_pept        complement(204184..205035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="SJA_C1-01970"
FT                   /product="D-alanine transaminase"
FT                   /EC_number="2.6.1.21"
FT                   /note="D-amino acid aminotransferase / branched-chain amino
FT                   acid aminotransferase / 4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95031"
FT                   /db_xref="GOA:D4YXE9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE9"
FT                   /protein_id="BAI95031.1"
FT                   /translation="MSIAYLNGRFVPLEQAQVSVLDRGFLFADGIYEVAAVIDGRLVDS
FT                   ASHLARLERSTGAIGIALPLSLAEVEAAQKELVARNGLTEGLVYLQITRGADATRDFLP
FT                   SPGIAPTLVMFVQAKPFLDVPAARNGIAVATMPDLRWARRDIKSVGLLAQAMAKRAAAE
FT                   AGAQEAWMVEDGFVTEGASSTAFIVTDEGIVTRPYSQAVLAGCTGAALNALAEESGIAV
FT                   IRRPFAVAEALAAREAFIASASTLCQSVVRIDGQAIGDGKPGPVAMRLRALYIDFARRT
FT                   AV"
     atgtccatcg cctatctgaa cggccgcttc gtcccgctgg aacaagccca ggtctccgtg        60
     ctggatcggg gtttcctgtt cgcggacggc atttatgagg tcgcggcggt gatcgacggc       120
     aggctggtcg acagcgcgtc ccatctcgcc cggctggagc ggtcgacagg ggccatcggc       180
     atcgccctgc ccctctccct cgcggaggtc gaggcggcgc agaaggaact ggtggcgcgc       240
     aacgggctga ccgaggggct ggtctatctt cagatcacgc ggggggccga cgcgacgcgg       300
     gatttcctgc cctcgcccgg catcgcgccg accctggtga tgttcgtgca ggccaagcct       360
     ttcctggacg tgcccgccgc gcgcaacggg atcgcagtcg cgaccatgcc cgacctgcgc       420
     tgggcgcggc gcgacatcaa gagcgtcggc ctgctcgccc aggccatggc caagcgcgcc       480
     gccgccgaag cgggcgcgca ggaggcgtgg atggtggagg acggcttcgt caccgaaggc       540
     gcgtcgtcca ccgccttcat cgtgacggac gaggggatcg tcacccggcc ctacagccag       600
     gcggtgctgg cgggctgcac cggcgcggcg ctgaacgcgc tggcggagga aagcggcatc       660
     gccgtcatcc gccgtccctt cgccgtcgcg gaagcattgg cggccaggga agccttcatc       720
     gccagcgcct ccaccctctg ccagtcggtg gtgaggatcg acggccaggc catcggcgac       780
     ggcaagcccg gcccggtcgc catgcggctg cgcgccctct atatcgactt tgcccgccgc       840
     acggcggttt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page